Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02580 101 / 1e-29 Plant protein 1589 of unknown function (.1.2) AT3G55240 98 / 3e-28 Plant protein 1589 of unknown function (.1) AT3G28990 95 / 5e-27 Plant protein 1589 of unknown function (.1) AT1G10657 73 / 5e-18 Plant protein 1589 of unknown function (.1.2.3.4) AT3G61700 52 / 3e-09 Plant protein 1589 of unknown function (.1.2) AT2G46420 52 / 4e-09 Plant protein 1589 of unknown function (.1.2) AT5G04090 51 / 8e-09 Plant protein 1589 of unknown function (.1.2) AT3G10250 51 / 1e-08 Plant protein 1589 of unknown function (.1.2) AT1G49700 46 / 6e-07 Plant protein 1589 of unknown function (.1.2) AT3G45800 46 / 7e-07 Plant protein 1589 of unknown function (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025300 [exp] 149 / 3e-48 AT5G02580 115 / 5e-35 Plant protein 1589 of unknown function (.1.2) Lus10030322 [exp] 61 / 2e-13 AT3G55240 83 / 1e-22 Plant protein 1589 of unknown function (.1) Lus10003293 [exp] 61 / 2e-13 AT3G55240 85 / 2e-23 Plant protein 1589 of unknown function (.1) Lus10031001 [exp] 54 / 8e-10 AT3G10250 392 / 3e-137 Plant protein 1589 of unknown function (.1.2) Lus10004016 [exp] 54 / 1e-09 AT3G61700 253 / 3e-83 Plant protein 1589 of unknown function (.1.2) Lus10035397 [exp] 54 / 1e-09 AT3G23270 526 / 2e-171 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10030264 [exp] 53 / 3e-09 AT2G46420 346 / 4e-117 Plant protein 1589 of unknown function (.1.2) Lus10019011 [exp] 49 / 5e-08 AT3G61700 212 / 4e-66 Plant protein 1589 of unknown function (.1.2) Lus10039340 [exp] 47 / 2e-07 AT3G61700 182 / 6e-55 Plant protein 1589 of unknown function (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G213500 [exp] 111 / 2e-33 AT5G02580 96 / 2e-27 Plant protein 1589 of unknown function (.1.2) Potri.010G211500 [exp] 109 / 1e-32 AT3G55240 113 / 3e-34 Plant protein 1589 of unknown function (.1) Potri.008G189100 [exp] 85 / 6e-23 AT1G10657 122 / 8e-38 Plant protein 1589 of unknown function (.1.2.3.4) Potri.010G042300 [exp] 81 / 3e-21 AT1G10657 119 / 1e-36 Plant protein 1589 of unknown function (.1.2.3.4) Potri.015G019500 [exp] 55 / 5e-10 AT3G61700 161 / 1e-46 Plant protein 1589 of unknown function (.1.2) Potri.002G169900 [exp] 53 / 2e-09 AT2G46420 500 / 1e-178 Plant protein 1589 of unknown function (.1.2) Potri.014G097800 [exp] 53 / 3e-09 AT2G46420 503 / 5e-180 Plant protein 1589 of unknown function (.1.2) Potri.016G038100 [exp] 52 / 6e-09 AT3G10250 381 / 5e-133 Plant protein 1589 of unknown function (.1.2) Potri.006G041200 [exp] 52 / 7e-09 AT3G10250 396 / 4e-139 Plant protein 1589 of unknown function (.1.2) Potri.012G001700 [exp] 51 / 9e-09 AT2G46420 165 / 3e-48 Plant protein 1589 of unknown function (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09713 [flax] [poplar] A_thal_3526 Plant protein 1589 of unknown function (A_thal_3526)
Representative CDS sequence Show only first row Show all	>Lus10024432 pacid=23174884 polypeptide=Lus10024432 locus=Lus10024432.g ID=Lus10024432.BGIv1.0 annot-version=v1.0 ATGGGCGACTCTCCTGCTTCTTACATACACATGGTGCATCGACTAATAGAGGAGTGTCTGGTATTCAACATGAGCAAAGAAGAGTGCATGGAAGCTCTGT CAAAGCACGCCAACATCAAACCCATCATCACCTCCACCGTCTGGAATGAGCTCCAGAAGGAGAACCCTGATTTCTTCCACGACTACAACACCCGCCGCCG CAGATCATCAACATCGTCTTCGTCGCCGGCACCTTCTACTCCACCTGCAACCACCGAACGGCGGATCCGAGCCCTGATCTCCGACCACCACGATACGACG TCGGATTGA
AA sequence Show only first row Show all	>Lus10024432 pacid=23174884 polypeptide=Lus10024432 locus=Lus10024432.g ID=Lus10024432.BGIv1.0 annot-version=v1.0 MGDSPASYIHMVHRLIEECLVFNMSKEECMEALSKHANIKPIITSTVWNELQKENPDFFHDYNTRRRRSSTSSSSPAPSTPPATTERRIRALISDHHDTT SD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02580			Plant protein 1589 of unknown ...		Lus10024432 [exp]	0	1
AT5G02580			Plant protein 1589 of unknown ...		Lus10025300 [exp]	11.0	0.8061
AT3G50330	bHLH	HEC2, bHLH037	HECATE 2, basic helix-loop-hel...		Lus10005710 [exp]	12.7	0.7881
AT4G35690			Arabidopsis protein of unknown...		Lus10028382 [exp]	22.8	0.7413
AT5G16770	MYB	ATMYB9	myb domain protein 9 (.1.2)		Lus10001093 [exp]	23.0	0.7869
AT3G06880			Transducin/WD40 repeat-like su...		Lus10023666 [exp]	24.7	0.7523
AT5G15240			Transmembrane amino acid trans...		Lus10030683 [exp]	31.0	0.7639
AT4G36380		ROT3	ROTUNDIFOLIA 3, Cytochrome P45...		Lus10041794 [exp]	37.1	0.7797
AT3G04780			Protein of unknown function (D...		Lus10001780 [exp]	87.8	0.7465
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10022776 [exp]	108.0	0.7290
					Lus10024524 [exp]	116.3	0.7384

Compare expression of checked genes

Lus10024432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.