Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02610 186 / 4e-62 Ribosomal L29 family protein (.1.2) AT3G09500 183 / 3e-61 Ribosomal L29 family protein (.1) AT2G39390 181 / 2e-60 Ribosomal L29 family protein (.1) AT3G55170 177 / 1e-58 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025292 [exp] 197 / 1e-66 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10003306 [exp] 182 / 2e-60 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10030314 [exp] 180 / 7e-60 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10019179 [exp] 179 / 3e-59 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 174 / 2e-57 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 139 / 1e-43 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G214100 [exp] 180 / 7e-60 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1) Potri.006G214200 [exp] 180 / 8e-60 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.010G212300 [exp] 178 / 2e-59 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 176 / 2e-58 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [flax] [poplar] Ribo_L29 PF00831 [flax] [poplar] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Lus10024437 pacid=23174899 polypeptide=Lus10024437 locus=Lus10024437.g ID=Lus10024437.BGIv1.0 annot-version=v1.0 ATGGCGAGGATTAAGGTTCACGAGTTGAGGACCAAGTCGAAGACAGATCTCTTGAACCAGGTCACGGAGCTCAAGTCCGAGGTTTCCCTACTCCGTGTCG CCAAGGTCACCGGAGGTGCACCTAACAAGCTCTCCAAGATCAAGGTGGTGAGACGGTCGATTGCGCAAGTGCTTACCGTGATTTCTCAGAAGCAGAAGGA AGCTCTCAGAGAAGCTTACAAGAACAAGAAGCTCTTGCCACTGGATCTGCGTCCCAAGAAGACTCGCGCCATCCGCCGACGCCTCACCAAGCACCAAGCA TCACTGAAGACAGAGCGAGAGAAGAAGCGGGAGATGTACTTCCCGTTGAGGAAATTCGCAATCAAAGTTTAG
AA sequence Show only first row Show all	>Lus10024437 pacid=23174899 polypeptide=Lus10024437 locus=Lus10024437.g ID=Lus10024437.BGIv1.0 annot-version=v1.0 MARIKVHELRTKSKTDLLNQVTELKSEVSLLRVAKVTGGAPNKLSKIKVVRRSIAQVLTVISQKQKEALREAYKNKKLLPLDLRPKKTRAIRRRLTKHQA SLKTEREKKREMYFPLRKFAIKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02610			Ribosomal L29 family protein ...		Lus10024437 [exp]	0	1
AT2G20980		MCM10	minichromosome maintenance 10 ...		Lus10019785 [exp]	9.8	0.8541
AT1G04870		PRMT10, ATPRMT1...	protein arginine methyltransfe...		Lus10019439 [exp]	13.0	0.8597
AT5G62290			nucleotide-sensitive chloride ...		Lus10038909 [exp]	18.7	0.8415
AT3G12390			Nascent polypeptide-associated...		Lus10024109 [exp]	19.8	0.8563
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10019682 [exp]	24.3	0.8458
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	26.8	0.8430
AT5G59180		NRPB7	DNA-directed RNA polymerase II...		Lus10004986 [exp]	27.5	0.7946
AT3G54490		RPB5E	"RNA polymerase II fifth large...		Lus10024169 [exp]	31.1	0.8297
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10014035 [exp]	31.5	0.8529
AT4G01040			Glycosyl hydrolase superfamily...		Lus10029447 [exp]	32.4	0.8089

Compare expression of checked genes

Lus10024437 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.