Lus10024445 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019815 233 / 1e-79 ND /
Lus10014101 232 / 4e-79 ND /
Lus10014099 229 / 3e-78 ND /
Lus10019813 229 / 5e-78 ND /
Lus10028949 196 / 5e-65 ND /
Lus10029851 151 / 4e-47 ND /
Lus10037860 151 / 5e-47 ND /
Lus10039879 141 / 5e-43 ND /
Lus10000191 141 / 6e-43 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G081800 188 / 1e-61 ND /
Potri.002G158600 184 / 2e-60 ND /
Potri.002G158700 182 / 1e-59 ND /
Potri.019G100100 180 / 2e-58 ND /
Potri.014G082700 176 / 3e-57 ND /
Potri.014G081900 173 / 9e-56 ND /
Potri.003G126200 157 / 2e-49 ND /
Potri.014G082000 149 / 2e-46 ND /
Potri.003G126400 116 / 5e-34 ND /
Potri.017G153100 110 / 9e-31 ND /
PFAM info
Representative CDS sequence
>Lus10024445 pacid=23170212 polypeptide=Lus10024445 locus=Lus10024445.g ID=Lus10024445.BGIv1.0 annot-version=v1.0
ATGCCGTATCCCCTTAACAAGTCAATCAAACTCTTGGATCGATATTCCGGAATTTCGGGATCACTCCGCCACCGGGGCAGTGTAAGTAACCAGGGAGAAG
AATCAGACTGTTGCAAGGCAGGCAAGCACTACACCACCTACAAATGTTCGCTTCCCGTGACTGGCCGAACTAAGGCCACTCTTACTTGGAACAGCTTCGA
GAACAAGTACCACCCTGATGACCATCTAGTCGTTGCACTGTCGACTGGATGGTTCAACAACAAGAGCAGGTGTCTCAACTTCATCAACATTTATGGGAAT
GGGAAGAGTGTTAGGGCTATGGTGGTTGATGAATGTGACTCCACCATGGGATGTGATACCAATCATGATTATCAGCCTCCTTGTCCTGATAACATCGTTG
ACGCTTCTAAAGTAATGTGGAAAGCGTTAGGAGTGCCCGAAAATAATTGA
AA sequence
>Lus10024445 pacid=23170212 polypeptide=Lus10024445 locus=Lus10024445.g ID=Lus10024445.BGIv1.0 annot-version=v1.0
MPYPLNKSIKLLDRYSGISGSLRHRGSVSNQGEESDCCKAGKHYTTYKCSLPVTGRTKATLTWNSFENKYHPDDHLVVALSTGWFNNKSRCLNFINIYGN
GKSVRAMVVDECDSTMGCDTNHDYQPPCPDNIVDASKVMWKALGVPENN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024445 0 1
AT2G35740 ATINT3 nositol transporter 3 (.1) Lus10017559 2.4 0.9135
Lus10016134 3.7 0.9024
Lus10035048 5.7 0.9268
AT1G02550 Plant invertase/pectin methyle... Lus10039849 6.9 0.8878
AT4G27570 UDP-Glycosyltransferase superf... Lus10039236 7.5 0.9117
AT2G43610 Chitinase family protein (.1) Lus10003586 15.4 0.8849
AT4G37445 unknown protein Lus10001408 15.4 0.9095
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10000180 17.3 0.9054
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006306 18.0 0.8947
Lus10035062 19.6 0.9038

Lus10024445 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.