Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24280 48 / 4e-08 alpha/beta-Hydrolases superfamily protein (.1) AT5G22860 42 / 5e-06 Serine carboxypeptidase S28 family protein (.1.2) AT5G65760 40 / 1e-05 Serine carboxypeptidase S28 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017002 [exp] 62 / 3e-13 AT2G24280 447 / 6e-155 alpha/beta-Hydrolases superfamily protein (.1) Lus10021325 [exp] 62 / 3e-13 AT2G24280 515 / 5e-180 alpha/beta-Hydrolases superfamily protein (.1) Lus10005353 [exp] 46 / 1e-07 AT5G22860 476 / 3e-165 Serine carboxypeptidase S28 family protein (.1.2) Lus10008358 [exp] 46 / 2e-07 AT5G22860 486 / 1e-168 Serine carboxypeptidase S28 family protein (.1.2) Lus10021400 [exp] 40 / 2e-05 AT5G22860 558 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Lus10039645 [exp] 39 / 4e-05 AT5G65760 374 / 7e-127 Serine carboxypeptidase S28 family protein (.1) Lus10005354 [exp] 39 / 4e-05 AT5G22860 557 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Lus10011603 [exp] 39 / 4e-05 AT5G65760 753 / 0.0 Serine carboxypeptidase S28 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G207900 [exp] 56 / 5e-11 AT2G24280 563 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G232300 [exp] 47 / 4e-08 AT5G22860 528 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Potri.018G018500 [exp] 47 / 6e-08 AT5G22860 522 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Potri.001G212900 [exp] 45 / 3e-07 AT5G22860 481 / 6e-167 Serine carboxypeptidase S28 family protein (.1.2) Potri.001G213300 [exp] 45 / 3e-07 AT5G22860 588 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Potri.001G213500 [exp] 45 / 3e-07 AT5G22860 593 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Potri.009G002300 [exp] 44 / 7e-07 AT5G22860 449 / 1e-154 Serine carboxypeptidase S28 family protein (.1.2) Potri.001G213200 [exp] 44 / 1e-06 AT5G22860 518 / 0.0 Serine carboxypeptidase S28 family protein (.1.2) Potri.001G213400 [exp] 44 / 1e-06 AT5G22860 514 / 8e-180 Serine carboxypeptidase S28 family protein (.1.2) Potri.007G008100 [exp] 43 / 1e-06 AT5G65760 783 / 0.0 Serine carboxypeptidase S28 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024449 pacid=23170219 polypeptide=Lus10024449 locus=Lus10024449.g ID=Lus10024449.BGIv1.0 annot-version=v1.0 ATGATAACTCCTCCTGCGACAAGGAGTACGACATTTTCCGTCGCAGAAACTGGATCACCACCGAATTCACAGAGGATTAAGGAAGTGCTGAAGAGGTATG GCAGCAACATCATCTTCTTCAATGGCTTGAGAGACCCTTGGAGTGGAGGAGGGTGTTGGAGAGTATCTCCAGCAGCATAG
AA sequence Show only first row Show all	>Lus10024449 pacid=23170219 polypeptide=Lus10024449 locus=Lus10024449.g ID=Lus10024449.BGIv1.0 annot-version=v1.0 MITPPATRSTTFSVAETGSPPNSQRIKEVLKRYGSNIIFFNGLRDPWSGGGCWRVSPAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10024449 [exp]	0	1
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	2.4	0.9856
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	3.5	0.9856
AT3G03380		DEG7, DEGP7	degradation of periplasmic pro...		Lus10017636 [exp]	3.5	0.9247
					Lus10000380 [exp]	4.2	0.9856
					Lus10010383 [exp]	4.9	0.9856
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10037911 [exp]	5.5	0.9849
					Lus10009632 [exp]	6.0	0.9826
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10015092 [exp]	7.0	0.9671
					Lus10033730 [exp]	7.7	0.8843
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	8.5	0.9536

Compare expression of checked genes

Lus10024449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.