Lus10024463 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024463 pacid=23170241 polypeptide=Lus10024463 locus=Lus10024463.g ID=Lus10024463.BGIv1.0 annot-version=v1.0
ATGGCGGTTTTCCAAGGCCAGGTAGCGACGGCAACGGAGGGGAGAAGCTTCGGCGGCGAGAGGGCAGCGTTCCAACTCCCAAGAAAGTTGGAGTTCGCTG
GTGGTCGGCGGAAACTGGACACAGCTCGCCTGCGGGGACCTAGTCCGCGGGAGAAGAAGAGGGACCAATCTGCAAGTCCAGAAAGACTTGGGCCAGTTTT
GTCAACGACTGGAAGTTTTGGATCAGCTAGTGTAACGAAGGCGTTTAGAGGACTAGCGCAACGTTTCGGTCCCAGCAAGTTTCAAAATATTGCAAAGAGG
TAA
AA sequence
>Lus10024463 pacid=23170241 polypeptide=Lus10024463 locus=Lus10024463.g ID=Lus10024463.BGIv1.0 annot-version=v1.0
MAVFQGQVATATEGRSFGGERAAFQLPRKLEFAGGRRKLDTARLRGPSPREKKRDQSASPERLGPVLSTTGSFGSASVTKAFRGLAQRFGPSKFQNIAKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024463 0 1
AT4G21510 F-box family protein (.1) Lus10022370 2.8 0.8377
AT4G32790 Exostosin family protein (.1) Lus10043238 4.9 0.8296
AT5G53080 Tetratricopeptide repeat (TPR)... Lus10005905 8.5 0.7869
AT4G19150 Ankyrin repeat family protein ... Lus10001414 11.0 0.7752
AT2G20725 CAAX amino terminal protease f... Lus10039818 11.0 0.7554
AT4G19540 INDH, INDL IND1(iron-sulfur protein requi... Lus10019468 11.0 0.7799
AT5G60335 Thioesterase superfamily prote... Lus10028483 12.6 0.7888
AT3G21810 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10031572 14.9 0.7569
AT2G35450 catalytics;hydrolases (.1) Lus10037047 16.3 0.8203
AT4G21190 EMB1417 embryo defective 1417, Pentatr... Lus10039292 19.0 0.7926

Lus10024463 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.