Lus10024470 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10270 170 / 3e-48 GRP23 glutamine-rich protein 23 (.1)
AT3G60960 94 / 3e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49240 83 / 5e-18 EMB1796 embryo defective 1796, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G60980 61 / 1e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18530 56 / 7e-09 Protein of unknown function (DUF707) (.1)
AT5G28340 55 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G28380 55 / 2e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G12840 52 / 7e-08 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
AT1G11170 50 / 7e-07 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
AT1G62914 48 / 3e-06 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024469 239 / 1e-72 AT1G10270 620 / 0.0 glutamine-rich protein 23 (.1)
Lus10002990 234 / 4e-71 AT1G10270 290 / 4e-86 glutamine-rich protein 23 (.1)
Lus10018109 81 / 2e-17 AT3G49240 763 / 0.0 embryo defective 1796, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022406 81 / 3e-17 AT3G49240 769 / 0.0 embryo defective 1796, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10002991 77 / 2e-16 AT4G18530 265 / 6e-87 Protein of unknown function (DUF707) (.1)
Lus10024473 73 / 6e-16 AT4G18530 135 / 6e-39 Protein of unknown function (DUF707) (.1)
Lus10029737 56 / 7e-09 AT1G63130 424 / 6e-140 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10042768 56 / 8e-09 AT1G12700 418 / 8e-138 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10015109 49 / 2e-06 AT1G09900 351 / 6e-114 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G227800 185 / 2e-53 AT1G10270 672 / 0.0 glutamine-rich protein 23 (.1)
Potri.003G002950 174 / 1e-49 AT1G10270 646 / 0.0 glutamine-rich protein 23 (.1)
Potri.012G015400 77 / 6e-16 AT3G49240 613 / 0.0 embryo defective 1796, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G227700 59 / 4e-10 AT4G18530 466 / 1e-164 Protein of unknown function (DUF707) (.1)
Potri.003G003100 57 / 2e-09 AT4G18530 480 / 4e-170 Protein of unknown function (DUF707) (.1)
Potri.001G236800 54 / 2e-08 AT5G59900 1071 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G175800 52 / 9e-08 AT4G12840 482 / 1e-170 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
Potri.003G105700 49 / 1e-06 AT4G19440 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.019G053000 49 / 1e-06 AT4G18530 444 / 4e-156 Protein of unknown function (DUF707) (.1)
Potri.017G131400 49 / 2e-06 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
CL0020 PF05212 DUF707 Protein of unknown function (DUF707)
Representative CDS sequence
>Lus10024470 pacid=23170226 polypeptide=Lus10024470 locus=Lus10024470.g ID=Lus10024470.BGIv1.0 annot-version=v1.0
ATGTCTCTTTACCGTGTCCTCCTTCTCAACCGCTCCTCTTCCTCATCTGCCACCTCCTATGCGCCATCCTTAACGCGAGCCCTCCACTACTTCACCTCAC
CACCCATCACCGCTTCCCTAATTCCCGCTCCTCAACTTTCAATCCCTTCATCGCGACGAAGTTTTGCCTTCTCCTCCGCTGAAGAAGCTGCCGCTGAACG
CCGCCGGCGGAAACGGCGCCTCCGCATCGAACCTCCGCTGCACGCTCTTCAGCGTAACCCTTACCCTCCTCCTCGGGATCCCAATGCTCCCCGTCTTCCC
GATTCCACTTCAGCTCTTGTTGGCCCTCGACTTAGCTTGCATAACAATGTCCAGTCGCTTATTAGAGCCTTTGATCTTGATGCTGCTTCTTACCTCGCTC
GCACCGCTGTTTTCTCCAGAACTAGGCCCACTGTCTTCACATGTAATGCGATTATAGCTGCTATGTATCGAGCTAAACGGTACAGTGACGCCATTGCTTT
GTTTAAGTACTTCTTCGAGCAAAATGATATAGTGCCTAATGTCGTCTCTTATAATAATGTGATCAACGCGCACTGTGATGAAGGGAGAGTTGATACAGGG
CTTGAGTCTGTTGTTCGGGGTGACAGGGCGAAAAATGTCGGTGTGGTCGATTCTGAGTACATAGTACACCTTGGCTTGCCCACACTTGGTGTCTTCAACA
AAACTCAGGCAAGTACAAGTAGCTCTTCTACCTAA
AA sequence
>Lus10024470 pacid=23170226 polypeptide=Lus10024470 locus=Lus10024470.g ID=Lus10024470.BGIv1.0 annot-version=v1.0
MSLYRVLLLNRSSSSSATSYAPSLTRALHYFTSPPITASLIPAPQLSIPSSRRSFAFSSAEEAAAERRRRKRRLRIEPPLHALQRNPYPPPRDPNAPRLP
DSTSALVGPRLSLHNNVQSLIRAFDLDAASYLARTAVFSRTRPTVFTCNAIIAAMYRAKRYSDAIALFKYFFEQNDIVPNVVSYNNVINAHCDEGRVDTG
LESVVRGDRAKNVGVVDSEYIVHLGLPTLGVFNKTQASTSSSST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10270 GRP23 glutamine-rich protein 23 (.1) Lus10024470 0 1
AT5G58450 Tetratricopeptide repeat (TPR)... Lus10026402 2.6 0.9337
AT5G35910 Polynucleotidyl transferase, r... Lus10020301 4.4 0.8942
AT2G34357 ARM repeat superfamily protein... Lus10041233 8.5 0.9237
AT1G10270 GRP23 glutamine-rich protein 23 (.1) Lus10002990 10.7 0.9150
AT5G40480 EMB3012 embryo defective 3012 (.1) Lus10022271 10.9 0.9263
AT2G31340 EMB1381 embryo defective 1381 (.1) Lus10035336 11.3 0.8975
AT2G34357 ARM repeat superfamily protein... Lus10041232 13.0 0.9176
AT2G17140 Pentatricopeptide repeat (PPR)... Lus10026545 14.8 0.9162
AT2G30780 Tetratricopeptide repeat (TPR)... Lus10029620 17.2 0.8881
AT1G64790 ILA ILITYHIA (.1.2) Lus10003101 22.1 0.9103

Lus10024470 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.