Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18530 135 / 7e-39 Protein of unknown function (DUF707) (.1) AT4G12840 114 / 9e-31 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G11170 100 / 1e-25 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G61240 97 / 2e-24 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) AT1G24570 62 / 9e-12 Protein of unknown function (DUF707) (.1) AT1G13000 61 / 1e-11 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT3G27470 57 / 2e-10 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G67850 56 / 6e-10 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT3G26440 56 / 9e-10 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) AT2G28310 55 / 1e-09 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002991 [exp] 241 / 2e-81 AT4G18530 265 / 6e-87 Protein of unknown function (DUF707) (.1) Lus10041107 [exp] 103 / 5e-27 AT4G12840 416 / 7e-145 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10036434 [exp] 103 / 6e-27 AT4G12840 402 / 9e-139 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10038303 [exp] 101 / 5e-26 AT1G61240 507 / 2e-179 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Lus10006728 [exp] 101 / 7e-26 AT1G61240 533 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Lus10018456 [exp] 96 / 7e-24 AT1G61240 504 / 1e-178 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Lus10011228 [exp] 96 / 1e-23 AT1G61240 507 / 4e-177 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Lus10024470 [exp] 74 / 2e-16 AT1G10270 209 / 3e-62 glutamine-rich protein 23 (.1) Lus10035229 [exp] 72 / 2e-15 AT1G67850 452 / 1e-159 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G227700 [exp] 127 / 4e-36 AT4G18530 466 / 1e-164 Protein of unknown function (DUF707) (.1) Potri.003G003100 [exp] 120 / 3e-33 AT4G18530 480 / 4e-170 Protein of unknown function (DUF707) (.1) Potri.014G175800 [exp] 116 / 6e-32 AT4G12840 482 / 1e-170 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.019G053000 [exp] 110 / 1e-29 AT4G18530 444 / 4e-156 Protein of unknown function (DUF707) (.1) Potri.011G045300 [exp] 101 / 4e-26 AT1G61240 534 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Potri.004G036800 [exp] 99 / 2e-25 AT1G61240 535 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Potri.008G185600 [exp] 63 / 3e-12 AT1G67850 610 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.010G047200 [exp] 58 / 2e-10 AT1G67850 581 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.009G011000 [exp] 55 / 1e-09 AT2G28310 608 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Potri.017G065200 [exp] 54 / 6e-09 AT3G27470 605 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05212 [flax] [poplar] DUF707 Protein of unknown function (DUF707)
Representative CDS sequence Show only first row Show all	>Lus10024473 pacid=23170195 polypeptide=Lus10024473 locus=Lus10024473.g ID=Lus10024473.BGIv1.0 annot-version=v1.0 ATGATGTTTCACTATGACGGTGCTGTAGAGAAATGGGAGGACCTGTCATGGAACGCTCGTACAGTCCACCTAGCTCCAGCACTTGATCCTTCTAAGTCAG AGGTGCACCATCCAATTACTGCTCGCAAAAGCAAATCTGCAGTTCACAGTTGGGTGGAAATGATGGCTCCTGTGTTCTCCAAGGCACTGGATCTCTCTAC TGTTCTCCTAACTTTCTGCTCTTTTGAAACACACCGATTATCAGTCTTTTGTTCAATGTTCATACAGAATGACTTGATCCACGCTTGGGGTTTGGATACG CAACTTGGTTACTGTGCACAAGGTGACAGGGTGAAAAATGTCGGTGTGGTCGATTCTGAGTACATAGTACACCTTGGCTTGCCTACACTTGGCGTCTTCA ACAAAACTCAGGCAACTACAAGTAGCTCTTCTACCTAA
AA sequence Show only first row Show all	>Lus10024473 pacid=23170195 polypeptide=Lus10024473 locus=Lus10024473.g ID=Lus10024473.BGIv1.0 annot-version=v1.0 MMFHYDGAVEKWEDLSWNARTVHLAPALDPSKSEVHHPITARKSKSAVHSWVEMMAPVFSKALDLSTVLLTFCSFETHRLSVFCSMFIQNDLIHAWGLDT QLGYCAQGDRVKNVGVVDSEYIVHLGLPTLGVFNKTQATTSSSST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18530			Protein of unknown function (D...		Lus10024473 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006310 [exp]	16.0	0.5621
AT4G35040	bZIP	bZIP19	Basic-leucine zipper (bZIP) tr...		Lus10016368 [exp]	22.0	0.5452
AT2G15220			Plant basic secretory protein ...		Lus10001607 [exp]	26.7	0.5410
					Lus10040759 [exp]	42.6	0.5286
AT4G38380			MATE efflux family protein (.1...		Lus10023944 [exp]	60.5	0.5223
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10014730 [exp]	92.0	0.5083
AT5G46940			Plant invertase/pectin methyle...		Lus10031483 [exp]	100.0	0.4712
AT1G29450			SAUR-like auxin-responsive pro...		Lus10025114 [exp]	108.2	0.4802
					Lus10020204 [exp]	127.8	0.4349
AT2G25010			Aminotransferase-like, plant m...		Lus10032693 [exp]	142.6	0.3767

Compare expression of checked genes

Lus10024473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.