Lus10024499 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23060 47 / 6e-07 IQD22 IQ-domain 22 (.1)
AT4G14750 42 / 3e-05 IQD19 IQ-domain 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017841 72 / 2e-15 AT4G23060 258 / 2e-80 IQ-domain 22 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G122800 54 / 3e-09 AT4G23060 109 / 1e-25 IQ-domain 22 (.1)
Potri.001G108800 54 / 4e-09 AT4G23060 179 / 1e-50 IQ-domain 22 (.1)
Potri.001G190500 45 / 4e-06 AT3G16490 293 / 5e-96 IQ-domain 26 (.1)
Potri.003G047800 42 / 4e-05 AT3G16490 299 / 1e-98 IQ-domain 26 (.1)
PFAM info
Representative CDS sequence
>Lus10024499 pacid=23170221 polypeptide=Lus10024499 locus=Lus10024499.g ID=Lus10024499.BGIv1.0 annot-version=v1.0
ATGGGAAAAGCTTCGCGGTGGTTCCGTTCCGTTCTCGGCCTCAAAAAGTCCGATCACTCCTCCTTCCCCACCACCTCTACTACCGCCGCCCGTCCCAAGG
AGAAACGCCGTTGGAGTTTTGTCAAATCCTACCGCGACAAAGACCACCACTCTCGCGACGCTTCCGCTTTCTCCTCCTCCTCCTTCATCAATGCCGTCCC
TGAAAACCATGAAGACGACGCCGACGACGAGAAGGAGGAGGCGAATCCCAGCAACCGTGCTATCGCCCCCCCCCACTGCTCTGGGCCGCCGCCCGGCCCC
CCCCCGCCGCGGTTGCCGAGGCAGCTGTGGCCGCTGCTCACGCCGCTGCGGAGGTCGTACGTCTTACCAGCAGCGGCAGGTCCACTGGAAACAGCGTAG
AA sequence
>Lus10024499 pacid=23170221 polypeptide=Lus10024499 locus=Lus10024499.g ID=Lus10024499.BGIv1.0 annot-version=v1.0
MGKASRWFRSVLGLKKSDHSSFPTTSTTAARPKEKRRWSFVKSYRDKDHHSRDASAFSSSSFINAVPENHEDDADDEKEEANPSNRAIAPPHCSGPPPGP
PPPRLPRQLWPLLTPLRRSYVLPAAAGPLETA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23060 IQD22 IQ-domain 22 (.1) Lus10024499 0 1
AT5G50670 SBP SPL13B SQUAMOSA PROMOTER-BINDING PROT... Lus10003126 6.5 0.8437
AT5G65590 DOF AtDof5,7 Dof-type zinc finger DNA-bindi... Lus10035955 9.4 0.8482
AT5G65590 DOF AtDof5,7 Dof-type zinc finger DNA-bindi... Lus10025707 27.7 0.8204
AT1G27950 LTPG1 glycosylphosphatidylinositol-a... Lus10037027 28.6 0.8274
AT4G23060 IQD22 IQ-domain 22 (.1) Lus10024498 29.1 0.7482
AT5G17510 unknown protein Lus10024530 30.6 0.7533
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Lus10009960 36.7 0.8126
AT1G24100 UGT74B1 UDP-glucosyl transferase 74B1 ... Lus10010712 40.3 0.8075
Lus10019266 42.0 0.7170
AT4G31380 FLP1 FPF1-like protein 1 (.1) Lus10040802 57.3 0.8040

Lus10024499 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.