Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024506 pacid=23170250 polypeptide=Lus10024506 locus=Lus10024506.g ID=Lus10024506.BGIv1.0 annot-version=v1.0 ATGGGAAGAGACGGTGCAGAAGGAAGATGGGAGGATGAGGATGGAAAGGAATCGGTTGGTGACGAAGAAATGAGGTGGGTGAGAGGAGGCAGAGAAGGGA TAGATTGGTGGGAAGCGGAGGGGGAGGCGGCGGAAAAGGGTTTAACAAAGGGTGTTTCTGTAGCCCAGCTCGAGTGGTAG
AA sequence Show only first row Show all	>Lus10024506 pacid=23170250 polypeptide=Lus10024506 locus=Lus10024506.g ID=Lus10024506.BGIv1.0 annot-version=v1.0 MGRDGAEGRWEDEDGKESVGDEEMRWVRGGREGIDWWEAEGEAAEKGLTKGVSVAQLEW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024506 [exp]	0	1
AT2G26975			Ctr copper transporter family ...		Lus10017205 [exp]	1.4	0.8065
AT4G35790		ATPLDDELTA	ARABIDOPSIS THALIANA PHOSPHOLI...		Lus10012699 [exp]	4.0	0.6632
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10031478 [exp]	5.2	0.7514
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10007013 [exp]	7.2	0.7582
					Lus10039495 [exp]	9.4	0.7070
					Lus10007991 [exp]	15.3	0.6870
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10026128 [exp]	17.7	0.6532
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Lus10030442 [exp]	24.5	0.6147
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Lus10029410 [exp]	25.8	0.6684
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Lus10005917 [exp]	28.1	0.6041

Compare expression of checked genes

Lus10024506 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.