Lus10024509 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04780 194 / 7e-65 MED21 mediator 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008009 241 / 2e-83 AT4G04780 202 / 3e-68 mediator 21 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G017100 202 / 3e-68 AT4G04780 207 / 2e-70 mediator 21 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11221 Med21 Subunit 21 of Mediator complex
Representative CDS sequence
>Lus10024509 pacid=23170217 polypeptide=Lus10024509 locus=Lus10024509.g ID=Lus10024509.BGIv1.0 annot-version=v1.0
ATGGATATAATTTCCCAATTACAAGAACAAATCGACACGGTAGCGTCTCTTGCTTTTAACTCTATCGGGACGTTGCAGAGAGATGCTCCGCCAGTGCGGT
TGTCGTCCAATTACCCTGAGCCGCCGCCAGCCCCCGTCAACCCCGCGGAGGATATTGTGGAGCAGCCTAGGCAGATGGGCACTGCTCTCGTCAAAGCTGC
TAAGCAGTTTGATGCTCTGGTGGCTGCACTTCCATTGTCCGAGGGTGGTGAAGAAGCTCAATTGAAAAGGATTGCTGAGCTGCAGGCTGAGAATGATGCT
GTAGGTCAAGAACTCCAGAAGCAACTTGAAGCTGCTGAGAAAGAGCTGAAACAGGTTGTGGAGCTATTTGGTCAAGCGACAGACAATTGCTTGAACCTGA
AGAAACCAGATTAG
AA sequence
>Lus10024509 pacid=23170217 polypeptide=Lus10024509 locus=Lus10024509.g ID=Lus10024509.BGIv1.0 annot-version=v1.0
MDIISQLQEQIDTVASLAFNSIGTLQRDAPPVRLSSNYPEPPPAPVNPAEDIVEQPRQMGTALVKAAKQFDALVAALPLSEGGEEAQLKRIAELQAENDA
VGQELQKQLEAAEKELKQVVELFGQATDNCLNLKKPD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G04780 MED21 mediator 21 (.1) Lus10024509 0 1
AT1G63460 ATGPX8 glutathione peroxidase 8 (.1) Lus10000601 8.7 0.8259
AT5G59460 scarecrow-like transcription f... Lus10004969 8.7 0.8334
AT5G12240 unknown protein Lus10026824 10.6 0.8266
AT2G37120 S1FA-like DNA-binding protein ... Lus10023177 12.0 0.8019
AT5G19930 Protein of unknown function DU... Lus10017753 12.4 0.8073
AT2G28930 APK1B protein kinase 1B (.1.2.3) Lus10040806 13.6 0.8197
AT1G67620 Lojap-related protein (.1) Lus10015822 13.9 0.8165
AT4G19070 Putative membrane lipoprotein ... Lus10015450 15.0 0.8012
AT5G26040 HDA2 histone deacetylase 2 (.1.2) Lus10024990 16.3 0.8168
AT3G27100 unknown protein Lus10012534 16.6 0.7948

Lus10024509 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.