Lus10024511 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11650 308 / 2e-106 ATOSM34 osmotin 34 (.1)
AT1G75050 184 / 1e-57 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75030 179 / 1e-55 ATLP-3 thaumatin-like protein 3 (.1)
AT1G77700 181 / 4e-55 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75040 169 / 7e-52 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT4G38660 170 / 6e-51 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75800 167 / 5e-50 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G73620 165 / 7e-50 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G20030 164 / 4e-49 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G18250 160 / 2e-48 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006302 299 / 5e-103 AT4G11650 294 / 3e-101 osmotin 34 (.1)
Lus10007034 289 / 6e-99 AT4G11650 293 / 5e-101 osmotin 34 (.1)
Lus10006690 285 / 2e-97 AT4G11650 292 / 1e-100 osmotin 34 (.1)
Lus10017170 246 / 4e-82 AT4G11650 251 / 2e-84 osmotin 34 (.1)
Lus10025629 182 / 2e-55 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10023897 176 / 2e-54 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10028447 170 / 3e-51 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10009058 166 / 3e-50 AT1G73620 376 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10032726 164 / 1e-49 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G102400 362 / 8e-128 AT4G11650 360 / 2e-127 osmotin 34 (.1)
Potri.001G107600 350 / 6e-123 AT4G11650 356 / 1e-125 osmotin 34 (.1)
Potri.018G096063 284 / 3e-97 AT4G11650 314 / 2e-109 osmotin 34 (.1)
Potri.001G107800 279 / 3e-95 AT4G11650 291 / 1e-100 osmotin 34 (.1)
Potri.001G107950 276 / 5e-94 AT4G11650 287 / 6e-99 osmotin 34 (.1)
Potri.002G087100 175 / 9e-54 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G222100 169 / 1e-51 AT1G75800 283 / 2e-95 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G173900 169 / 3e-51 AT1G77700 316 / 2e-107 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221900 165 / 4e-50 AT1G75800 271 / 5e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.009G132500 167 / 9e-50 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10024511 pacid=23170206 polypeptide=Lus10024511 locus=Lus10024511.g ID=Lus10024511.BGIv1.0 annot-version=v1.0
ATGACCCACTTTCCCATTTTGCTCATCCCCTTGTTTTCCTCCTTGCTACTTTGGGTCTCCATCACCAATGCAGCTGTGATTGACATCTTCAACAACTGTC
CTTACACAGTCTGGGCAGCTTCCACGCCCATTGGTGGCGGTCGTCAACTCGACCACGGACAAACATGGACCATCTACCCTCCCGCTGGAACTTCAATGGC
CCGCATTTGGGGCCGCCGGAATTGCAACTTTGATGGCAGCGGTAGGGGTTGGTGCGAGACTGGCGATTGTGGTGGGGTCCTCAACTGTCAGGGTTGGGGT
GTCCCGCCGAACACTCTAGCTGAGTACGCCCTTAACCAATTCTCGAATTTGGACTTCTACGACATATCGTTGGTGGACGGGTTCAACATTCCTATGATCT
TCACCCCCACGGCAAACGTGGGTTCAGGTAACTGCCAGAGCCTAACTTGCACGGCTGACATCAACACACAGTGCCCTGGTGAGTTGCGGGCCCCGGGCGG
GTGCAACAACCCTTGTACCGTGTTCAAGACCAATGAGTATTGTTGCACTCAGGGGTACGGGACTTGCGGTCCGACTGGATTTTCAAGATTCTTTAAGGAT
AGGTGTCCGACTTCTTATAGTTACCCTCAGGACGATCCAAGCAGTACGTTCACTTGCCCCGGCGGTACCAACTATAGAGTGGTGTTTTGCCCCTATGGCT
CTACTCATCCTGACATCGACACCAACAACAACAACAATAACAACAAGAATGTGACGTTGGCTATGGTGACCGAGAAGATCAATTCTGAGTAG
AA sequence
>Lus10024511 pacid=23170206 polypeptide=Lus10024511 locus=Lus10024511.g ID=Lus10024511.BGIv1.0 annot-version=v1.0
MTHFPILLIPLFSSLLLWVSITNAAVIDIFNNCPYTVWAASTPIGGGRQLDHGQTWTIYPPAGTSMARIWGRRNCNFDGSGRGWCETGDCGGVLNCQGWG
VPPNTLAEYALNQFSNLDFYDISLVDGFNIPMIFTPTANVGSGNCQSLTCTADINTQCPGELRAPGGCNNPCTVFKTNEYCCTQGYGTCGPTGFSRFFKD
RCPTSYSYPQDDPSSTFTCPGGTNYRVVFCPYGSTHPDIDTNNNNNNNKNVTLAMVTEKINSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10024511 0 1
AT3G26270 CYP71B25 "cytochrome P450, family 71, s... Lus10019463 1.7 0.9862
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10043313 2.8 0.9761
AT3G26040 HXXXD-type acyl-transferase fa... Lus10019183 3.5 0.9684
AT3G48310 CYP71A22 "cytochrome P450, family 71, s... Lus10019462 4.2 0.9634
AT4G16260 Glycosyl hydrolase superfamily... Lus10016883 4.2 0.9743
AT4G29680 Alkaline-phosphatase-like fami... Lus10034660 4.6 0.9628
AT1G17860 Kunitz family trypsin and prot... Lus10011090 5.0 0.9670
AT5G44390 FAD-binding Berberine family p... Lus10008410 5.0 0.9440
AT5G56350 Pyruvate kinase family protein... Lus10003439 5.5 0.9567
AT1G22430 GroES-like zinc-binding dehydr... Lus10005656 5.7 0.9480

Lus10024511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.