Lus10024514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23750 107 / 1e-29 Remorin family protein (.1.2)
AT3G61260 97 / 2e-25 Remorin family protein (.1)
AT3G48940 89 / 5e-23 Remorin family protein (.1)
AT2G45820 80 / 3e-19 Remorin family protein (.1)
AT1G63295 55 / 5e-10 Remorin family protein (.1)
AT3G57540 56 / 8e-10 Remorin family protein (.1)
AT2G41870 53 / 8e-09 Remorin family protein (.1)
AT1G67590 42 / 4e-05 Remorin family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008014 169 / 7e-55 AT5G23750 158 / 5e-50 Remorin family protein (.1.2)
Lus10008477 135 / 4e-40 AT5G23750 154 / 5e-47 Remorin family protein (.1.2)
Lus10001477 131 / 9e-39 AT5G23750 162 / 3e-50 Remorin family protein (.1.2)
Lus10014785 97 / 5e-26 AT3G61260 177 / 1e-56 Remorin family protein (.1)
Lus10039215 95 / 7e-25 AT3G61260 196 / 7e-64 Remorin family protein (.1)
Lus10018840 95 / 9e-25 AT3G61260 206 / 1e-67 Remorin family protein (.1)
Lus10027460 94 / 3e-24 AT3G61260 192 / 2e-62 Remorin family protein (.1)
Lus10017811 93 / 4e-24 AT3G61260 199 / 5e-65 Remorin family protein (.1)
Lus10030379 83 / 3e-20 AT3G61260 178 / 4e-57 Remorin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G124400 99 / 2e-26 AT5G23750 129 / 6e-38 Remorin family protein (.1.2)
Potri.014G081300 98 / 3e-26 AT3G61260 199 / 4e-65 Remorin family protein (.1)
Potri.002G157700 93 / 2e-24 AT3G61260 167 / 2e-52 Remorin family protein (.1)
Potri.015G143600 91 / 3e-23 AT5G23750 111 / 1e-30 Remorin family protein (.1.2)
Potri.012G140800 85 / 7e-21 AT5G23750 98 / 2e-25 Remorin family protein (.1.2)
Potri.001G107000 80 / 3e-19 AT5G23750 55 / 2e-09 Remorin family protein (.1.2)
Potri.016G054400 54 / 4e-09 AT2G41870 206 / 7e-66 Remorin family protein (.1)
Potri.006G053200 52 / 3e-08 AT3G57540 196 / 2e-61 Remorin family protein (.1)
Potri.008G144300 50 / 1e-07 AT2G02170 431 / 5e-147 Remorin family protein (.1.2)
Potri.014G027900 48 / 5e-07 AT1G45207 442 / 1e-149 Remorin family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03763 Remorin_C Remorin, C-terminal region
Representative CDS sequence
>Lus10024514 pacid=23170224 polypeptide=Lus10024514 locus=Lus10024514.g ID=Lus10024514.BGIv1.0 annot-version=v1.0
ATGGGAGAAGTGGCAAACGTTCGCGTTGCTGAGACATCATTGGAGGCTGCTATCCCTGTGCCAGCTGTTGCTGCTGAGAATAAGAACGAACCTGCCGTCT
GCAAGACGAACACCCCCTCCCCTGTATCTGAAAATCAACGTATGCCCTTCCCTCTCTTGCTTCTGAACTTATGTTCCTGCCTTATTCCTGCTTGGACTTA
CAAAAGGCTCTGTGCAATCACATCGTGGGAGAACACCAAGAAATCAGCAGTAGAAGCGCAGATAAAGGAACACGAGAAGAAGAGGGCTGAATACGTTGAG
AGAACGCAAAACAAGCTAGCTGAAATTCATAAGGAAGCAGAGGAGAATAGGGCACTGATTGAAGCAAATAAAGGTCAAGAGTATGTGAAGATTGAGGAAA
CTGCAATCACATACAGAGCCACTGGGTACCCACCAAAGAAGTTTTTCAGTTGCTTAGGTTGCTAA
AA sequence
>Lus10024514 pacid=23170224 polypeptide=Lus10024514 locus=Lus10024514.g ID=Lus10024514.BGIv1.0 annot-version=v1.0
MGEVANVRVAETSLEAAIPVPAVAAENKNEPAVCKTNTPSPVSENQRMPFPLLLLNLCSCLIPAWTYKRLCAITSWENTKKSAVEAQIKEHEKKRAEYVE
RTQNKLAEIHKEAEENRALIEANKGQEYVKIEETAITYRATGYPPKKFFSCLGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G23750 Remorin family protein (.1.2) Lus10024514 0 1
AT4G35230 BSK1 BR-signaling kinase 1 (.1) Lus10003329 5.7 0.7698
AT4G24290 MAC/Perforin domain-containing... Lus10015324 7.7 0.7298
AT5G23090 CCAAT NF-YB13 "nuclear factor Y, subunit B13... Lus10009614 8.6 0.7397
AT2G04880 WRKY ATWRKY1, ZAP1 zinc-dependent activator prote... Lus10006368 13.4 0.6613
AT3G13600 calmodulin-binding family prot... Lus10016052 15.8 0.7070
AT4G07990 Chaperone DnaJ-domain superfam... Lus10032795 21.4 0.6883
AT2G20990 SYT1, NTMC2TYPE... SYNAPTOTAGMIN 1, ARABIDOPSIS T... Lus10019782 22.4 0.6552
AT1G70740 Protein kinase superfamily pro... Lus10001595 22.8 0.7024
AT1G77920 bZIP bZIP transcription factor fami... Lus10009055 31.1 0.6514
AT2G43210 Ubiquitin-like superfamily pro... Lus10025504 31.3 0.7294

Lus10024514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.