Lus10024528 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024528 pacid=23169601 polypeptide=Lus10024528 locus=Lus10024528.g ID=Lus10024528.BGIv1.0 annot-version=v1.0
ATGTGCCAGAACCTTGCTCAATCCAGATGGCCGGAATTCTGGTCCGTCTCCTCTAATAACCCGAGTTCGAATCTCACTTCCAGGAATCGAACGAAATCGA
ACAACAAACCTTCCCCTCTGCAAGAAACGTCGACGTCTGACCCCGTAGCTGGGAACTCGATTGAAAGGAAGGTGTTCTCCGCCGGTGGGGATCTCCTTTC
TTTGATTCAAATCGCCAACCTGACCGAAGTCAAACTAAGAGTTTCCGCAGGCCGACGCTTCGTTCATCGGGATCGGACTCCTAGAGAGATTCAAAGCCTG
CAGAGCATCGGTCTAGCTTCGTAG
AA sequence
>Lus10024528 pacid=23169601 polypeptide=Lus10024528 locus=Lus10024528.g ID=Lus10024528.BGIv1.0 annot-version=v1.0
MCQNLAQSRWPEFWSVSSNNPSSNLTSRNRTKSNNKPSPLQETSTSDPVAGNSIERKVFSAGGDLLSLIQIANLTEVKLRVSAGRRFVHRDRTPREIQSL
QSIGLAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024528 0 1
AT2G23460 ATXLG1, XLG1 extra-large G-protein 1 (.1) Lus10019655 13.9 0.7515
AT5G56610 Phosphotyrosine protein phosph... Lus10012928 16.5 0.7360
AT1G24764 ATMAP70-2 microtubule-associated protein... Lus10019171 18.2 0.7134
AT1G29400 AML5 MEI2-like protein 5 (.1.2) Lus10011968 20.6 0.7411
AT5G49610 F-box family protein (.1) Lus10037619 22.0 0.6079
AT3G04240 SEC secret agent, Tetratricopeptid... Lus10004779 26.1 0.6900
AT3G06580 GAL1, GALK GALACTOSE KINASE 1, Mevalonate... Lus10016321 31.6 0.6992
AT5G51070 SAG15, CLPD, ER... SENESCENCE ASSOCIATED GENE 15,... Lus10043014 33.2 0.7223
AT3G20860 ATNEK5 NIMA-related kinase 5 (.1) Lus10011301 36.1 0.7101
AT1G53570 MAPKKK3, MAP3KA MAP KINASE KINASE KINASE 3, mi... Lus10000829 43.4 0.6909

Lus10024528 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.