Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52490 57 / 5e-11 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) AT4G29920 40 / 2e-05 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042638 [exp] 114 / 2e-35 AT3G52490 53 / 9e-10 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009953 [exp] 108 / 8e-32 AT3G52490 68 / 1e-13 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10004526 [exp] 104 / 7e-29 AT3G52490 75 / 1e-14 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10021291 [exp] 99 / 5e-26 AT3G52490 690 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10016966 [exp] 99 / 5e-26 AT3G52490 606 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022117 [exp] 65 / 1e-15 ND 39 / 1e-04 Lus10008970 [exp] 49 / 2e-08 AT3G52490 460 / 1e-147 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10028849 [exp] 47 / 1e-07 AT3G52490 498 / 5e-165 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204500 [exp] 53 / 7e-10 AT3G52490 852 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Potri.008G017600 [exp] 49 / 2e-08 AT3G52490 635 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G241600 [exp] 46 / 3e-07 AT3G52490 641 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Potri.018G140900 [exp] 40 / 2e-05 AT5G57130 751 / 0.0 Clp amino terminal domain-containing protein (.1) Potri.006G073800 [exp] 38 / 0.0002 AT4G29920 693 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024536 pacid=23169604 polypeptide=Lus10024536 locus=Lus10024536.g ID=Lus10024536.BGIv1.0 annot-version=v1.0 ATGGTGAGTTTGATTGAGAATTTAGTGAGCAATCGGTCGAGAAGGCGAGGGGTAGATATCGTGGGAGGGTGCCTTAGTACGGCTGAAGGTGTTCTGAAAG GAGTGATGGAAAAGGTCGAGAACGGTGAGGTACCTGAGGTTCTGAGGGGAGCTAAGTTCGTATCCATTGTGTTTTGGGTAGCTTTGTACAACAGAGGAGG TGGAACAGAAAGTTGA
AA sequence Show only first row Show all	>Lus10024536 pacid=23169604 polypeptide=Lus10024536 locus=Lus10024536.g ID=Lus10024536.BGIv1.0 annot-version=v1.0 MVSLIENLVSNRSRRRGVDIVGGCLSTAEGVLKGVMEKVENGEVPEVLRGAKFVSIVFWVALYNRGGGTES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	0	1
					Lus10005297 [exp]	1.7	1.0000
AT5G53910			RING/U-box superfamily protein...		Lus10011380 [exp]	2.4	1.0000
					Lus10013260 [exp]	3.0	1.0000
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10032426 [exp]	4.2	0.9848
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011745 [exp]	4.9	0.9586
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	4.9	1.0000
AT2G06090			Plant self-incompatibility pro...		Lus10011896 [exp]	5.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10011644 [exp]	5.7	0.9790
					Lus10006529 [exp]	6.0	1.0000
					Lus10035557 [exp]	6.5	1.0000

Compare expression of checked genes

Lus10024536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.