Lus10024547 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024547 pacid=23169599 polypeptide=Lus10024547 locus=Lus10024547.g ID=Lus10024547.BGIv1.0 annot-version=v1.0
ATGGAAACTTTCGGACTCTCATCATGCGCTAGGATTTCAATCAAACTCGATGTGCCTCTTCCTTATGGCTGTTGGGCAAGTGATGATGTAGAAGCCGAGT
GGGTAAATTACAAGTTCGAGAAACTTCCTTCATCTTTCTGCTATGATTGTGGAAGGGTCGGACATAACAACAACTCATGCGATTTTAAAGATGAATATGT
AGCAAAATGCTACGGAGAACACACAAGATCCGGAATATACTCGTCGTATGCTCCAATGCCGGCGAGGTTTGTTAGAACCGAAACTGGAGGAAATGGAGAG
GAATAA
AA sequence
>Lus10024547 pacid=23169599 polypeptide=Lus10024547 locus=Lus10024547.g ID=Lus10024547.BGIv1.0 annot-version=v1.0
METFGLSSCARISIKLDVPLPYGCWASDDVEAEWVNYKFEKLPSSFCYDCGRVGHNNNSCDFKDEYVAKCYGEHTRSGIYSSYAPMPARFVRTETGGNGE
E

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024547 0 1
AT1G55020 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, li... Lus10008202 1.4 0.8691
AT5G64360 EIP9 EMF1-Interacting Protein 1, Ch... Lus10002650 7.7 0.6862
AT4G35370 Transducin/WD40 repeat-like su... Lus10004613 12.5 0.7177
AT2G04410 RPM1-interacting protein 4 (RI... Lus10016623 14.1 0.7543
AT3G27210 unknown protein Lus10035217 15.4 0.7715
AT2G39370 MAKR4 MEMBRANE-ASSOCIATED KINASE REG... Lus10030311 16.7 0.7292
Lus10029450 20.1 0.8081
AT1G16890 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 1... Lus10017654 29.2 0.7169
AT5G58060 ATYKT61, ATGP1,... SNARE-like superfamily protein... Lus10019047 30.8 0.7225
AT5G18910 Protein kinase superfamily pro... Lus10012776 38.5 0.6385

Lus10024547 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.