Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028176 [exp] 108 / 1e-28 AT1G02080 2621 / 0.0 transcription regulators (.1.2) Lus10042876 [exp] 107 / 5e-28 AT1G02080 1161 / 0.0 transcription regulators (.1.2) Lus10024660 [exp] 82 / 3e-19 AT1G02080 2743 / 0.0 transcription regulators (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G143000 [exp] 45 / 2e-06 AT1G02080 1868 / 0.0 transcription regulators (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024551 pacid=23169603 polypeptide=Lus10024551 locus=Lus10024551.g ID=Lus10024551.BGIv1.0 annot-version=v1.0 ATGGACTTTGTTCGGCTTCCATGGCAAAGTCAGTCTACCCAGGGGTATTCTTCTGGTGTAGTGGGTTTGGGATTCGAGGCAACTCAAACATTGGATCTGG GTTCTGAGGCAATTGATTTAAATTCAGCAGCACTTCCAAGTTCTTCCTCAATAAGTATTGGAGCAGATGCTACTGTACTATCTACTGAATCTAAGCTGGT AGATCCTTTCGATAATTTGAACGTTGAACAAATACCTGTTTCTCCTGTTTTGTGTGCAGATGGTGTGATTGGGATAAGAATCGTTGCTACTGATGTTGGA TTAGTTGCGAGTGGGATTGCTCCTACTTTGGCGTGA
AA sequence Show only first row Show all	>Lus10024551 pacid=23169603 polypeptide=Lus10024551 locus=Lus10024551.g ID=Lus10024551.BGIv1.0 annot-version=v1.0 MDFVRLPWQSQSTQGYSSGVVGLGFEATQTLDLGSEAIDLNSAALPSSSSISIGADATVLSTESKLVDPFDNLNVEQIPVSPVLCADGVIGIRIVATDVG LVASGIAPTLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024551 [exp]	0	1
AT5G14590			Isocitrate/isopropylmalate deh...		Lus10013090 [exp]	6.2	0.9050
AT4G02120			CTP synthase family protein (....		Lus10010020 [exp]	7.5	0.9028
AT1G04590		EMB2748	unknown protein		Lus10019008 [exp]	11.2	0.8962
AT2G35450			catalytics;hydrolases (.1)		Lus10015759 [exp]	11.3	0.9100
AT4G02120			CTP synthase family protein (....		Lus10025042 [exp]	13.1	0.9058
AT1G24880		AtLpxC2	lipid X C2, UDP-3-O-acyl N-ace...		Lus10001592 [exp]	25.1	0.8846
AT5G12230		MED19A	unknown protein		Lus10002150 [exp]	25.9	0.8903
AT2G19560		ESSP1, AtTHP1, ...	ectopic expression of seed sto...		Lus10008561 [exp]	25.9	0.8809
AT1G79610		ATNHX6	Na+/H+ antiporter 6, ARABIDOPS...		Lus10039131 [exp]	30.0	0.8900
AT2G14255			Ankyrin repeat family protein ...		Lus10040833 [exp]	31.8	0.8884

Compare expression of checked genes

Lus10024551 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.