Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28540 47 / 1e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025433 [exp] 103 / 8e-31 AT1G28540 111 / 7e-33 unknown protein Lus10015296 [exp] 60 / 7e-13 AT4G17500 73 / 7e-17 ethylene responsive element binding factor 1 (.1) Lus10042196 [exp] 0 / 1 AT1G28540 71 / 1e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G051300 [exp] 54 / 4e-11 AT1G28540 102 / 1e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024553 pacid=23169579 polypeptide=Lus10024553 locus=Lus10024553.g ID=Lus10024553.BGIv1.0 annot-version=v1.0 ATGGCTAAACCCGAAAAACCAAATTCTCCACCTGCGACAGAGCTCAAGGGCGTCGGAAAAAACAACAACAACAACACCAGCTACTCGGGACAAAAGCTCC ATTACCTAAACTTGTCAGAGGGGGTAAACCCGGACGCAGCGACTATAAGGGATCAGTGGCAATTCGCCATAAAGCAGTACAACAGGTAG
AA sequence Show only first row Show all	>Lus10024553 pacid=23169579 polypeptide=Lus10024553 locus=Lus10024553.g ID=Lus10024553.BGIv1.0 annot-version=v1.0 MAKPEKPNSPPATELKGVGKNNNNNTSYSGQKLHYLNLSEGVNPDAATIRDQWQFAIKQYNR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28540			unknown protein		Lus10024553 [exp]	0	1
					Lus10003893 [exp]	8.6	0.8844
AT4G10790			UBX domain-containing protein ...		Lus10039951 [exp]	12.8	0.8745
AT1G31500			DNAse I-like superfamily prote...		Lus10026203 [exp]	16.1	0.8234
					Lus10034352 [exp]	16.2	0.8666
AT1G54400			HSP20-like chaperones superfam...		Lus10013655 [exp]	18.4	0.8588
					Lus10009927 [exp]	22.3	0.8553
					Lus10002859 [exp]	23.9	0.8578
					Lus10032767 [exp]	25.7	0.8526
AT3G48200			unknown protein		Lus10008827 [exp]	26.1	0.8303
AT2G38510			MATE efflux family protein (.1...		Lus10025156 [exp]	29.6	0.8370

Compare expression of checked genes

Lus10024553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.