Lus10024560 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53020 197 / 1e-65 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 197 / 2e-65 RPL24A ribosomal protein L24 (.1)
AT2G44860 72 / 2e-16 Ribosomal protein L24e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032198 225 / 2e-76 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1)
Lus10006314 214 / 4e-71 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 214 / 8e-71 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
Lus10008640 209 / 7e-70 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1)
Lus10035584 208 / 1e-69 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1)
Lus10014637 100 / 5e-28 AT2G36620 100 / 6e-28 ribosomal protein L24 (.1)
Lus10020552 78 / 2e-18 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G085300 206 / 8e-69 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.015G141900 203 / 7e-68 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139400 202 / 2e-67 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139500 202 / 2e-67 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.003G123101 194 / 3e-64 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.009G148500 73 / 2e-16 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G187800 72 / 2e-16 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Lus10024560 pacid=23161658 polypeptide=Lus10024560 locus=Lus10024560.g ID=Lus10024560.BGIv1.0 annot-version=v1.0
ATGGTTTTGAAGACTGAGCTATGCCGTTTCAGCGGTCAGAAGATTTACCCCGGCAGGGGGATCAGATTCATACGATCTGATTCTCAGGTTTTCCTCTTTG
CCAACTCGAAATGCAAGAGGTACTTCCACAACCGATTGAAGCCTTCGAAGCTCACCTGGACCGCCGTGTTCAGGAAGCAGCACAAGAAGGACATTGCTGC
TGAGGCTGTGAAGAAGAAGAGAAGGACCAACAAGAAGCCTTACTCGAGGTCCATTGTCGGTGCTTCCTTGGAGGTGATTCAGAAGAGGAGGGCTGAAAAG
CCCGAAGTCCGAGACGCTGCTCGTGAAGCTGCCATTCGTGAAATCAAGGAGAGGATTAAGAAGACCAAGGATGAGAAGAAGGCGAAGAAGGCTGAAGTTT
CCAAGTCACAGAAGGGCCAAGGGAAGAGTGGTATGCCTAGGGGTGCTGCACCGAAGGGAGGTCCCAAGCTCGGCGGTGGCGGTGGAAAGCGATGA
AA sequence
>Lus10024560 pacid=23161658 polypeptide=Lus10024560 locus=Lus10024560.g ID=Lus10024560.BGIv1.0 annot-version=v1.0
MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAVFRKQHKKDIAAEAVKKKRRTNKKPYSRSIVGASLEVIQKRRAEK
PEVRDAAREAAIREIKERIKKTKDEKKAKKAEVSKSQKGQGKSGMPRGAAPKGGPKLGGGGGKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10024560 0 1
AT2G31410 unknown protein Lus10031995 1.0 0.8886
AT3G02080 Ribosomal protein S19e family ... Lus10020836 4.5 0.8626
AT3G53740 Ribosomal protein L36e family ... Lus10016501 13.0 0.8381
AT2G09990 Ribosomal protein S5 domain 2-... Lus10038012 13.0 0.8201
AT5G27470 seryl-tRNA synthetase / serine... Lus10017409 13.3 0.8219
AT3G10530 Transducin/WD40 repeat-like su... Lus10037324 13.4 0.8256
AT1G76010 Alba DNA/RNA-binding protein (... Lus10017255 14.7 0.8346
AT3G44010 Ribosomal protein S14p/S29e fa... Lus10039155 21.0 0.8059
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10032198 27.0 0.8058
AT1G53850 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALP... Lus10003936 27.2 0.8110

Lus10024560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.