Lus10024576 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61110 146 / 1e-46 ARS27A ribosomal protein S27 (.1)
AT2G45710 138 / 1e-43 Zinc-binding ribosomal protein family protein (.1)
AT5G47930 137 / 3e-43 Zinc-binding ribosomal protein family protein (.1)
AT3G61111 121 / 8e-37 Zinc-binding ribosomal protein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032212 151 / 8e-49 AT3G61110 173 / 2e-58 ribosomal protein S27 (.1)
Lus10031979 149 / 1e-47 AT3G61110 173 / 2e-58 ribosomal protein S27 (.1)
Lus10035122 148 / 1e-47 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1)
Lus10031974 148 / 1e-47 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1)
Lus10006697 47 / 6e-07 AT4G12560 80 / 4e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10007040 45 / 4e-06 AT3G06240 86 / 4e-18 F-box family protein (.1)
Lus10032343 44 / 1e-05 AT1G07700 218 / 9e-71 Thioredoxin superfamily protein (.1.2.3)
Lus10011015 39 / 0.0004 AT3G06240 94 / 7e-21 F-box family protein (.1)
Lus10035128 0 / 1 AT3G61110 84 / 1e-32 ribosomal protein S27 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G069100 145 / 2e-46 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1)
Potri.003G161200 145 / 2e-46 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1)
Potri.006G192900 145 / 2e-46 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF01667 Ribosomal_S27e Ribosomal protein S27
Representative CDS sequence
>Lus10024576 pacid=23161529 polypeptide=Lus10024576 locus=Lus10024576.g ID=Lus10024576.BGIv1.0 annot-version=v1.0
ATGTCGGCACAAACTCGAAACCTCGTACGACATGATAACCTAATGGAGACTCGCTCCCCGTTGTCAGGGAAGCTAAAGCATGACGATCATCATATTGATA
CACCAGGCACAAATACTGTCCGTCTCCCTGAACTTCGGTCCTCCCCCATACGTACTCTGGTGCTGCAAAACGATGTTGACTTGTTGAACCCACCGGCTGA
GCTTGAGAAGAGGAAGCACAAGCTCAAGCGTCTTGTCCAATCTCCCAATTCCTTCTTCATGGATGTGAAGTGCCAAGGTTGCTTCAACATAACTACTGTG
TTCAGCCACTCTCAAACTGTCGTAGTTTGCGGGAACTGCCAGAGTGTCCTGTGCCAGCCTACTGGAGGACGTGCTAGACTCACCGAGGGATGCTCTTTCC
GGAGGAAGGCTGACTAA
AA sequence
>Lus10024576 pacid=23161529 polypeptide=Lus10024576 locus=Lus10024576.g ID=Lus10024576.BGIv1.0 annot-version=v1.0
MSAQTRNLVRHDNLMETRSPLSGKLKHDDHHIDTPGTNTVRLPELRSSPIRTLVLQNDVDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTV
FSHSQTVVVCGNCQSVLCQPTGGRARLTEGCSFRRKAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10024576 0 1
AT5G24510 60S acidic ribosomal protein f... Lus10028876 3.2 0.9558
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10032212 3.3 0.9569
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Lus10012057 4.0 0.9414
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10022881 7.1 0.9238
AT5G57290 60S acidic ribosomal protein f... Lus10010890 7.3 0.9364
AT3G55010 EMB2818, ATPURM... EMBRYO DEFECTIVE 2818, phospho... Lus10039497 9.4 0.9233
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10015841 10.8 0.9481
AT4G35850 Pentatricopeptide repeat (PPR)... Lus10022296 11.8 0.9220
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Lus10032591 11.8 0.9365
AT4G39200 Ribosomal protein S25 family p... Lus10023552 13.9 0.9319

Lus10024576 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.