Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14100 72 / 2e-15 CYP705A13 "cytochrome P450, family 705, subfamily A, polypeptide 13", cytochrome P450, family 705, subfamily A, polypeptide 13 (.1) AT4G15350 71 / 6e-15 CYP705A2 "cytochrome P450, family 705, subfamily A, polypeptide 2", cytochrome P450, family 705, subfamily A, polypeptide 2 (.1) AT4G12320 71 / 1e-14 CYP706A6 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) AT4G12300 70 / 1e-14 CYP706A4 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) AT3G32047 69 / 2e-14 Cytochrome P450 superfamily protein (.1) AT2G05180 69 / 3e-14 CYP705A6 "cytochrome P450, family 705, subfamily A, polypeptide 6", cytochrome P450, family 705, subfamily A, polypeptide 6 (.1) AT3G20950 69 / 5e-14 CYP705A32 "cytochrome P450, family 705, subfamily A, polypeptide 32", cytochrome P450, family 705, subfamily A, polypeptide 32 (.1) AT3G20130 67 / 1e-13 GPS1, CYP705A22 gravity persistence signal 1, "cytochrome P450, family 705, subfamily A, polypeptide 22", cytochrome P450, family 705, subfamily A, polypeptide 22 (.1.2) AT2G45570 67 / 2e-13 CYP76C2 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) AT3G20090 66 / 2e-13 CYP705A18 "cytochrome P450, family 705, subfamily A, polypeptide 18", cytochrome P450, family 705, subfamily A, polypeptide 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024577 [exp] 122 / 5e-33 AT4G12300 444 / 3e-152 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10035196 [exp] 120 / 6e-33 AT4G12300 308 / 7e-101 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032026 [exp] 120 / 1e-32 AT4G12300 464 / 1e-159 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10024580 [exp] 115 / 4e-31 AT4G12310 344 / 2e-114 "cytochrome P450, family 706, subfamily A, polypeptide 5", cytochrome P450, family 706, subfamily A, polypeptide 5 (.1) Lus10032213 [exp] 112 / 2e-29 AT4G12300 453 / 1e-155 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10024578 [exp] 110 / 9e-29 AT4G12320 437 / 7e-149 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10032211 [exp] 108 / 5e-28 AT4G12320 432 / 2e-147 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10032215 [exp] 106 / 3e-27 AT4G12300 462 / 1e-158 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032214 [exp] 105 / 6e-27 AT4G12320 433 / 2e-147 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G118400 [exp] 91 / 1e-21 AT4G12300 429 / 9e-146 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Potri.003G114400 [exp] 81 / 3e-18 AT4G12320 495 / 1e-171 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Potri.013G073300 [exp] 76 / 9e-17 AT5G07990 711 / 0.0 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.007G084400 [exp] 69 / 2e-14 AT4G36220 267 / 2e-85 ferulic acid 5-hydroxylase 1 (.1) Potri.014G021700 [exp] 69 / 2e-14 AT5G10600 436 / 7e-149 "cytochrome P450, family 81, subfamily K, polypeptide 2", cytochrome P450, family 81, subfamily K, polypeptide 2 (.1) Potri.007G082900 [exp] 69 / 3e-14 AT3G26300 377 / 2e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G083500 [exp] 69 / 4e-14 AT3G26300 377 / 2e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G084800 [exp] 69 / 5e-14 AT3G26300 380 / 3e-127 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G084200 [exp] 68 / 6e-14 AT3G26300 385 / 1e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G083000 [exp] 68 / 8e-14 AT3G26330 368 / 8e-123 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10024582 pacid=23161535 polypeptide=Lus10024582 locus=Lus10024582.g ID=Lus10024582.BGIv1.0 annot-version=v1.0 ATGGGTGTTGAAAGCCTCAAGTTCGGAAAGGGTGCAGAGCCTGCTGACACTCATGAATGTGACCAAAGACCTAGGAGTGAGATTGATAAGCAAGTTAGGG AGTTGATGGATGGAGAGATAGGGAAGGAGATAAAAGAAAGAGCCATGGAGTGGAAAAAATTGGCTGACGAGGTAACTCAAGGTGAAATTGGACAAGCTTA CTTGAACTTGAGTGACATGATCAATAAGGATACGATTGTCGGTGCAACAGACACAACATCAACTACAATAGAATGGACGATGGCAATGCTGATGAAACAT CCAGATGCAATGCATAATGTCTGCAAAGAACTAGACGAAGCAGTAGGAAGAACAAACCTTGTCAAAGAGTTACATCTGCCGAAGCTTCGCTACTTGGATG CAGCGATTAAGGAAACATTCCGGCTGCAGCACTGCCGATCCTGCTGCCCCGTTACCCGAGCCAAGACTGCAAAATAA
AA sequence Show only first row Show all	>Lus10024582 pacid=23161535 polypeptide=Lus10024582 locus=Lus10024582.g ID=Lus10024582.BGIv1.0 annot-version=v1.0 MGVESLKFGKGAEPADTHECDQRPRSEIDKQVRELMDGEIGKEIKERAMEWKKLADEVTQGEIGQAYLNLSDMINKDTIVGATDTTSTTIEWTMAMLMKH PDAMHNVCKELDEAVGRTNLVKELHLPKLRYLDAAIKETFRLQHCRSCCPVTRAKTAK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14100		CYP705A13	"cytochrome P450, family 705, ...		Lus10024582 [exp]	0	1
AT2G37240			Thioredoxin superfamily protei...		Lus10019900 [exp]	3.2	0.9085
AT5G66780			unknown protein		Lus10024013 [exp]	3.5	0.9164
AT5G52390			PAR1 protein (.1)		Lus10016450 [exp]	4.1	0.9261
AT2G40100		LHCB4.3	light harvesting complex photo...		Lus10030403 [exp]	4.2	0.8886
					Lus10026075 [exp]	4.5	0.8880
AT2G30900		TBL43	TRICHOME BIREFRINGENCE-LIKE 43...		Lus10007367 [exp]	6.0	0.9213
AT4G16160		ATOEP16-2, ATOE...	Mitochondrial import inner mem...		Lus10016878 [exp]	6.8	0.8560
AT3G44910		ATCHX12	cation/H+ exchanger 12, cation...		Lus10040962 [exp]	7.7	0.8710
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10035628 [exp]	11.5	0.8879
AT5G18470			Curculin-like (mannose-binding...		Lus10003099 [exp]	13.1	0.9086

Compare expression of checked genes

Lus10024582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.