Lus10024588 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12340 94 / 1e-24 copper ion binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032225 239 / 2e-81 AT4G12340 134 / 4e-40 copper ion binding (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G114200 161 / 7e-51 AT4G12340 119 / 1e-34 copper ion binding (.1)
Potri.001G118700 158 / 1e-49 AT4G12340 124 / 2e-36 copper ion binding (.1)
PFAM info
Representative CDS sequence
>Lus10024588 pacid=23161575 polypeptide=Lus10024588 locus=Lus10024588.g ID=Lus10024588.BGIv1.0 annot-version=v1.0
ATGGAGAACTTTACACTTAAAATCACCAAGGAGCTTGTCGACCGTCTTTCTGGCGATGAAGAGAAAGCAAGGAAAAGAACAAGGAAACCGAAACCTAAAG
TTCCAAAACAGCCTCAACAACCTCGAACAAAGGCAAACGAGAAGCCACACCATGAAGAATCCAAGCCTCAGAAGGTGCCTGCTGCTCCTGGATGGCCAGT
TCAGCCTCCGATCTTCTTGCCCGCCCAACCACCACCTGTTCATCCAGCCAGCGCGGAGCTTGATGCAATTCGATCCGTCGTTCAGGAGAGCGAAAAGGTT
CTTGAGAAGCTCCAGAAGCAGGAGGAGCACATGGTGCAAGAAGTGACCGAAAGAGCCAAGGATTTGCACGGCAAGGAGTTCAAGCTTCCGTACCAGAAGC
CTATGCCCTGTGTGGCTGACTATGAAGCTTGCCGGTCTTGCTACAAGGAACACATCAATGACATCCTCAGATGCAGCCCTCTCACCAAGAGCTACTACGA
ATGCGTCCAGAGAGTAAAACAGCAAGCAGGGTCTGTGGATAAGTAG
AA sequence
>Lus10024588 pacid=23161575 polypeptide=Lus10024588 locus=Lus10024588.g ID=Lus10024588.BGIv1.0 annot-version=v1.0
MENFTLKITKELVDRLSGDEEKARKRTRKPKPKVPKQPQQPRTKANEKPHHEESKPQKVPAAPGWPVQPPIFLPAQPPPVHPASAELDAIRSVVQESEKV
LEKLQKQEEHMVQEVTERAKDLHGKEFKLPYQKPMPCVADYEACRSCYKEHINDILRCSPLTKSYYECVQRVKQQAGSVDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12340 copper ion binding (.1) Lus10024588 0 1
AT4G12340 copper ion binding (.1) Lus10032225 1.0 0.9289
AT1G27310 NTF2A nuclear transport factor 2A (.... Lus10035202 3.0 0.8974
AT3G48680 AtCAL2, GAMMACA... gamma carbonic anhydrase-like ... Lus10031278 3.2 0.9043
AT1G14550 Peroxidase superfamily protein... Lus10004218 3.7 0.8535
AT5G13430 Ubiquinol-cytochrome C reducta... Lus10041870 4.2 0.8811
AT5G58290 RPT3 regulatory particle triple-A A... Lus10006854 5.3 0.8942
AT1G52530 unknown protein Lus10003678 6.0 0.8581
AT5G23290 PFD5, PDF5 prefoldin 5 (.1) Lus10017381 7.9 0.8011
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10009565 8.5 0.8737
AT4G29870 Oligosaccharyltransferase comp... Lus10003228 8.9 0.8813

Lus10024588 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.