Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62790 83 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G70250 86 / 4e-20 receptor serine/threonine kinase, putative (.1) AT1G18280 67 / 4e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73550 64 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G73560 64 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G13900 49 / 1e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 49 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 46 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12360 45 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 44 / 8e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032228 [exp] 167 / 6e-54 AT1G70250 90 / 1e-23 receptor serine/threonine kinase, putative (.1) Lus10031335 [exp] 64 / 2e-12 AT3G17910 414 / 3e-142 SURFEIT 1, EMBRYO DEFECTIVE 3121, Surfeit locus 1 cytochrome c oxidase biogenesis protein (.1) Lus10014681 [exp] 47 / 1e-06 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042984 [exp] 46 / 2e-06 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 45 / 4e-06 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 45 / 4e-06 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032488 [exp] 45 / 6e-06 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 41 / 0.0001 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10035975 [exp] 40 / 0.0003 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G119000 [exp] 101 / 7e-28 AT1G62790 90 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G113900 [exp] 94 / 1e-24 AT1G70250 73 / 9e-16 receptor serine/threonine kinase, putative (.1) Potri.013G131500 [exp] 64 / 1e-13 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G036201 [exp] 48 / 2e-07 AT1G18280 96 / 3e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 45 / 5e-06 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G169000 [exp] 43 / 3e-05 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 42 / 4e-05 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 41 / 7e-05 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 41 / 0.0001 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G056200 [exp] 40 / 0.0003 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024591 pacid=23161583 polypeptide=Lus10024591 locus=Lus10024591.g ID=Lus10024591.BGIv1.0 annot-version=v1.0 ATGGCTTCCACCTCCTCCTCCACCACGGCGGCGCTCATCGTCCTCCTGGCCATCACCGCGATCACTGTCACCTATGCTCAGGGAAACAGCGCCAACAACA TTCCGTCCTGCGCCTCGAAGCTAGTCCCCTGCGCACAGTACATCGCCAACACCACCGAGAAGCCACCGGCGACCTGCTGCGACCCGATCAAGGAGACCGT CAAAACCGAGCTTACTTGCCTCTGCAACCTCTACAACACCCCCGGATTGCTCGAATCCTTAGGGATCAACGTCACCCAGGCCGTCGGCCTCACAACTCGC TGCGGAATCAGCGCCGACACCAGCTCCTGCAGCACAATCACGGCACAGTCACCGGGAGCTCCTGCCGTTCCAACTCCTCCGTCGAGAGCGGAGAACACCA ACAGCAACAGCAACAGTGGAAGCAGCAAGATGGCATGGGCTGGATTCTCGAGCTTGCTCTTGATATTTGCTGCCTCGTCGTTCTTTTAG
AA sequence Show only first row Show all	>Lus10024591 pacid=23161583 polypeptide=Lus10024591 locus=Lus10024591.g ID=Lus10024591.BGIv1.0 annot-version=v1.0 MASTSSSTTAALIVLLAITAITVTYAQGNSANNIPSCASKLVPCAQYIANTTEKPPATCCDPIKETVKTELTCLCNLYNTPGLLESLGINVTQAVGLTTR CGISADTSSCSTITAQSPGAPAVPTPPSRAENTNSNSNSGSSKMAWAGFSSLLLIFAASSFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62790			Bifunctional inhibitor/lipid-t...		Lus10024591 [exp]	0	1
AT2G16230			O-Glycosyl hydrolases family 1...		Lus10040461 [exp]	1.0	0.9094
AT5G07740			actin binding (.1)		Lus10017556 [exp]	6.9	0.8743
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Lus10038882 [exp]	11.0	0.8435
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Lus10015004 [exp]	13.9	0.8531
AT1G18640		PSP	3-phosphoserine phosphatase (....		Lus10040521 [exp]	15.4	0.8817
AT4G22910		CCS52A1, FZR2	cell cycle switch protein 52 ...		Lus10024482 [exp]	16.2	0.8102
AT5G22070			Core-2/I-branching beta-1,6-N-...		Lus10013361 [exp]	18.9	0.8325
AT1G79340		AtMCP2d, ATMC4	metacaspase 2d, metacaspase 4 ...		Lus10001835 [exp]	22.0	0.8091
AT3G52710			unknown protein		Lus10022708 [exp]	24.5	0.7998
AT1G19300		ATGATL1, GATL1,...	PARVUS, GAOLAOZHUANGREN 1, GAL...		Lus10018801 [exp]	29.0	0.8773

Compare expression of checked genes

Lus10024591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.