Lus10024593 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62770 131 / 2e-38 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 127 / 1e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 123 / 4e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 121 / 2e-34 PME1 pectin methylesterase inhibitor 1 (.1)
AT4G25260 114 / 8e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 103 / 1e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 101 / 2e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G70720 97 / 4e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 97 / 4e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G20740 95 / 3e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032230 278 / 6e-96 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 140 / 9e-42 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 138 / 4e-41 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 118 / 3e-33 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 113 / 2e-31 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 110 / 4e-30 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031132 102 / 3e-27 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 96 / 2e-24 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038645 92 / 8e-23 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G127500 133 / 3e-39 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 133 / 5e-39 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 132 / 6e-39 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.008G132600 109 / 1e-29 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119200 103 / 5e-29 AT1G62770 117 / 2e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G109300 103 / 3e-27 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 101 / 9e-27 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G145800 101 / 1e-26 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 100 / 3e-26 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 100 / 4e-26 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10024593 pacid=23161578 polypeptide=Lus10024593 locus=Lus10024593.g ID=Lus10024593.BGIv1.0 annot-version=v1.0
ATGGCAAACCATCTTCTTCGTCCTCTTCTACTTCTGGTTCCATCCCTCCTGATAACCACCACAACCTCAGCCATCAACCCAAAACAACAACCATCACCCT
TCATATCATCATCATGCAAGCTTACCCTCTACCCAGACCTCTGCATCCAATCACTCTCCCCTTTCTCAACCTCCATCCGCCAGAACGACCACCGCCACCT
CGCCCTCACTGCCCTCTCCTTCAGCCTCTCCCGCGCCAGGTCCGCCTCCTCCTACATCTCCGCCGTCCTCCGCCCCGGCCGCCCCAGTCCGGCAGCACTA
AACCAGGCGGTCAACGACTGCATCCGCAACATGGCCGACGGGGTCGCCCGGCTGACCCAGTCGGTCAGCGAGCTCGGTCAGATGGGCTCGGGCGGGCCAG
AGGATCGGTTCCAGTGGCACATGAGTAACTTGCAGACGTGGGTGAGTACTGCGCTGACCTGCGAGAACAGCTGCCTTGACGGGTTTAATTCGTTGGATGG
TCCGGTTAAGAATGCGGTTCGAAACCGGGTTGTTTACGTGGCTAAGGTTACGAGTAATGCTCTTGCCTTGATTCATGGGTTTGCTTCTAAGCATGACCGT
CCTGGGAGGCTTCCTTGA
AA sequence
>Lus10024593 pacid=23161578 polypeptide=Lus10024593 locus=Lus10024593.g ID=Lus10024593.BGIv1.0 annot-version=v1.0
MANHLLRPLLLLVPSLLITTTTSAINPKQQPSPFISSSCKLTLYPDLCIQSLSPFSTSIRQNDHRHLALTALSFSLSRARSASSYISAVLRPGRPSPAAL
NQAVNDCIRNMADGVARLTQSVSELGQMGSGGPEDRFQWHMSNLQTWVSTALTCENSCLDGFNSLDGPVKNAVRNRVVYVAKVTSNALALIHGFASKHDR
PGRLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62770 Plant invertase/pectin methyle... Lus10024593 0 1
AT1G62770 Plant invertase/pectin methyle... Lus10032230 4.2 0.9446
AT4G35200 Arabidopsis protein of unknown... Lus10022635 5.9 0.9283
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10003022 7.1 0.9315
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10011052 10.1 0.9415
AT4G35200 Arabidopsis protein of unknown... Lus10003332 12.0 0.9217
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10007385 18.3 0.9285
AT5G60520 Late embryogenesis abundant (L... Lus10036107 21.2 0.9282
AT5G24070 Peroxidase superfamily protein... Lus10025586 23.2 0.9163
AT2G28690 Protein of unknown function (D... Lus10005884 24.5 0.8797
AT3G21330 bHLH bHLH087 basic helix-loop-helix (bHLH) ... Lus10009745 27.5 0.9165

Lus10024593 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.