Lus10024595 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62760 118 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 91 / 1e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 82 / 2e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 81 / 1e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 78 / 2e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 77 / 3e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 76 / 5e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 76 / 9e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 75 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 72 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032232 313 / 2e-109 AT1G62760 141 / 9e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 170 / 3e-53 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 169 / 9e-53 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 94 / 1e-23 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 94 / 1e-23 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031717 93 / 3e-23 AT5G62360 179 / 3e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 92 / 6e-23 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 90 / 5e-22 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 88 / 2e-21 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G113600 115 / 5e-32 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 113 / 4e-31 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 107 / 1e-28 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 102 / 4e-27 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 94 / 6e-24 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 87 / 4e-21 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 87 / 4e-21 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 81 / 6e-19 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128500 81 / 1e-18 AT4G25250 144 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 78 / 1e-17 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10024595 pacid=23161633 polypeptide=Lus10024595 locus=Lus10024595.g ID=Lus10024595.BGIv1.0 annot-version=v1.0
ATGAACACAACTTCAGCAGTAGCAGCAATCTTCACACTAATCATCATCTCCGCCAAACTCCTCCATTCAGCCGCTGCCGCCGACGAACCAACCACCACTG
CGGACTTCATCAAAACCTCCTGCAACTCAACCCTCTACCGCAAGCTCTGCTTCCGAACACTCTCCCCGTACGCCTCCGAAATCGGATCCGACCCGAAACT
CCTCGCACTCAAGTCCCTCAACATAACCCTCGAAGTCACCCAATCCGCATCCAAGCTCATGAAGCGAATCGCCCGGATCCCCGGCGTCACCGGAGCGGCG
GCGGACTGTGTCGAGGAGGTCGAGAATGCGGTGGATGCTCTGGCGAAGTCGATTGGAGAACTCGGCGGGGCTCCGAAAGGAGGTGGACCCGGGTTCTGTC
GGGTCATCGACGACGTGGAGACTTTTGTAAGCGCGGCGGAGACGTTCGACGAGACGTGTATTGATGGGTTTGAGGAGGCGCCGGGGAAGGTGGTTGGTGG
GTCTTTGTCGGCGGCTAAGGTTAACCGGAATGCGAAGAAGATTGTAGAGAAGAGAGTGAAGAAGGTTGAGAAGTATACGAGTAACTGTTTGGCTTTGGTT
GATCTTTATGCTTCTGTGGAATTTCGCCATGTTAAGTGTTGA
AA sequence
>Lus10024595 pacid=23161633 polypeptide=Lus10024595 locus=Lus10024595.g ID=Lus10024595.BGIv1.0 annot-version=v1.0
MNTTSAVAAIFTLIIISAKLLHSAAAADEPTTTADFIKTSCNSTLYRKLCFRTLSPYASEIGSDPKLLALKSLNITLEVTQSASKLMKRIARIPGVTGAA
ADCVEEVENAVDALAKSIGELGGAPKGGGPGFCRVIDDVETFVSAAETFDETCIDGFEEAPGKVVGGSLSAAKVNRNAKKIVEKRVKKVEKYTSNCLALV
DLYASVEFRHVKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62760 Plant invertase/pectin methyle... Lus10024595 0 1
AT3G03990 alpha/beta-Hydrolases superfam... Lus10018686 3.5 0.8472
AT1G43670 FINS1, AtcFBP FRUCTOSE INSENSITIVE 1, Arabid... Lus10018885 7.5 0.8263
AT4G25000 AMY1, AMY3, ATA... alpha-amylase-like (.1) Lus10021728 23.6 0.8294
AT2G18250 ATCOAD 4-phosphopantetheine adenylylt... Lus10041759 36.9 0.8082
AT3G13062 Polyketide cyclase/dehydrase a... Lus10034791 46.1 0.8135
AT1G51720 Amino acid dehydrogenase famil... Lus10006872 60.7 0.7943
AT2G41510 ATCKX1, CKX1 cytokinin oxidase/dehydrogenas... Lus10018039 69.8 0.7505
Lus10037345 91.7 0.7407
AT4G31750 WIN2 HOPW1-1-interacting 2 (.1) Lus10020104 94.3 0.7845
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Lus10031177 103.5 0.7769

Lus10024595 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.