Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70720 82 / 1e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 82 / 1e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 82 / 2e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 81 / 4e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 81 / 5e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 79 / 1e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 75 / 5e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 75 / 6e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 75 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 70 / 6e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032233 [exp] 261 / 5e-90 AT5G62360 97 / 3e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 88 / 6e-22 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 88 / 6e-22 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 88 / 8e-22 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 85 / 1e-20 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038645 [exp] 82 / 2e-19 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10037919 [exp] 77 / 9e-18 AT1G14890 137 / 3e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027199 [exp] 77 / 2e-17 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 76 / 2e-17 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G109300 [exp] 84 / 3e-20 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128900 [exp] 82 / 9e-20 AT4G25250 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 81 / 2e-19 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 81 / 3e-19 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 79 / 1e-18 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 79 / 1e-18 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 79 / 2e-18 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G132600 [exp] 79 / 2e-18 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 79 / 2e-18 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128700 [exp] 78 / 4e-18 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10024596 pacid=23161672 polypeptide=Lus10024596 locus=Lus10024596.g ID=Lus10024596.BGIv1.0 annot-version=v1.0 ATGAACACTTCATCAACCTTCCTCCTTCTCCTCCTAATTACAGCCATCTCCGCAGCCGACACGGATTACATCCAAACCTCATGCCAAGCCTCGACTCGCT ACCCGGACCTATGCATCTCAACCTTGTCCCCACAAGCCTCCAACATAACCACCCCGAAGCTCCTCGCCTCGGCCGCCCTCTATGCAGCCCTGGCCGCGGC CAAGTCCACTTCGAAATCGATCGAGACAAGGCCGTCCTCTTGGAGTTCCCGGTTGAGGGACTGCAGGGAGGAGATGAGTGACTCTGTGGACCGGCTCCGC GACTCGGCCAAGGAGATGAAAGGTGAGGTAGTGCTGAGTAGGTTCCAGGTCAGCAACGTGCAGACGTGGGCCAGCGCTGCGATGACGTGTATGGACACGT GTACAGATGGGTTGGTGGAAGGGGAGGTGAAAAGATGGGTTGTGGAGAGGAGTGGGATTGTGAAGGCTGGGTTTCTGATTAGTAATGCCTTGGCTTTTGT TAATAAGTATGGTGATGGTCTTGTTAATCAGTGA
AA sequence Show only first row Show all	>Lus10024596 pacid=23161672 polypeptide=Lus10024596 locus=Lus10024596.g ID=Lus10024596.BGIv1.0 annot-version=v1.0 MNTSSTFLLLLLITAISAADTDYIQTSCQASTRYPDLCISTLSPQASNITTPKLLASAALYAALAAAKSTSKSIETRPSSWSSRLRDCREEMSDSVDRLR DSAKEMKGEVVLSRFQVSNVQTWASAAMTCMDTCTDGLVEGEVKRWVVERSGIVKAGFLISNALAFVNKYGDGLVNQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62360			Plant invertase/pectin methyle...		Lus10024596 [exp]	0	1
AT5G10530			Concanavalin A-like lectin pro...		Lus10007077 [exp]	2.4	0.9177
AT1G78160		APUM7	pumilio 7 (.1)		Lus10041139 [exp]	2.8	0.9005
AT1G03440			Leucine-rich repeat (LRR) fami...		Lus10031601 [exp]	3.0	0.9121
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10036704 [exp]	3.5	0.9098
AT1G71760			unknown protein		Lus10004010 [exp]	3.9	0.9088
AT5G67100		ICU2	INCURVATA2, DNA-directed DNA p...		Lus10019338 [exp]	4.9	0.9279
AT4G15790			unknown protein		Lus10004794 [exp]	6.9	0.8675
AT2G31050			Cupredoxin superfamily protein...		Lus10039842 [exp]	8.5	0.8789
AT2G21790		ATRNR1, RNR1, C...	CRINKLY LEAVES 8, RIBONUCLEOTI...		Lus10020845 [exp]	11.5	0.9087
AT3G19210		ATRAD54, CHR25	homolog of RAD54 (.1.2)		Lus10014047 [exp]	12.4	0.9051

Compare expression of checked genes

Lus10024596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.