Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12090 89 / 6e-23 ELP extensin-like protein (.1) AT4G12510 82 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 82 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 82 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 81 / 7e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G22460 81 / 8e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 77 / 5e-18 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 73 / 3e-17 AIR1 Auxin-Induced in Root cultures 1 (.1) AT4G12490 74 / 6e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G00165 73 / 6e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024616 [exp] 222 / 2e-75 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 217 / 1e-73 ND 139 / 2e-43 Lus10032254 [exp] 206 / 3e-69 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 109 / 4e-31 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 102 / 3e-28 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032260 [exp] 100 / 1e-27 AT4G12520 155 / 5e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 99 / 7e-27 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 99 / 9e-27 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 97 / 5e-26 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G111400 [exp] 110 / 1e-31 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 101 / 6e-28 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 100 / 1e-27 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 83 / 8e-21 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 79 / 3e-19 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 72 / 9e-17 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 73 / 8e-16 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 67 / 8e-15 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 65 / 1e-13 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G200100 [exp] 49 / 6e-08 AT4G12470 69 / 8e-16 azelaic acid induced 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024615 pacid=23161674 polypeptide=Lus10024615 locus=Lus10024615.g ID=Lus10024615.BGIv1.0 annot-version=v1.0 ATGAAGAGAAATGATTACAAAAGCGAAAGTACGATACGGCCACATTCCCATAACCTCTTCGGTCATATGGTTCATCAACATTGGAAGTTAGGTGGGACAG AGGTGCCACACACATTAAGCAGCAAGCTAAGCGCGACAGGAATGTTGAGGTTGATTCCGAGAATGTTGGCCTTGATGGCTGTACAAAGACAAACCGCCAC TTCCAAATCGACCAACCCTTCCAAAAGACTGCAACACGGCTTGACCGGTGGAGATCCAACCTTAGCGTGGACCAAGTTGAGCACGTTGGCACACACACCC AACTTAAGCGTGTCCCTCGGGCATTTTCCTAACGGGGTGGGGTTAGGGTTAGGGTTAGGGTTAGGTTTAGGCCATGGCTTTGGGGTCGGGCAGCCACCTC CACAGGCCGAGACCGGGGAGGTGGTGAAGATGAGCAAGTTGAGGGCTAGGAAGATGGCAATGGTCTTGGTTGCAGCCATGATGTTTTGGGGAAATAGGGT TTTGTGA
AA sequence Show only first row Show all	>Lus10024615 pacid=23161674 polypeptide=Lus10024615 locus=Lus10024615.g ID=Lus10024615.BGIv1.0 annot-version=v1.0 MKRNDYKSESTIRPHSHNLFGHMVHQHWKLGGTEVPHTLSSKLSATGMLRLIPRMLALMAVQRQTATSKSTNPSKRLQHGLTGGDPTLAWTKLSTLAHTP NLSVSLGHFPNGVGLGLGLGLGLGHGFGVGQPPPQAETGEVVKMSKLRARKMAMVLVAAMMFWGNRVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024615 [exp]	0	1
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024616 [exp]	1.7	0.9824
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10017285 [exp]	2.4	0.9746
					Lus10032253 [exp]	2.8	0.9812
AT2G01830		CRE1, AHK4, WOL...	WOODEN LEG 1, WOODEN LEG, CYTO...		Lus10028992 [exp]	2.8	0.9781
					Lus10005394 [exp]	3.5	0.9783
AT4G25320	AT-hook		AT hook motif DNA-binding fami...		Lus10031118 [exp]	5.2	0.9736
AT3G19850			Phototropic-responsive NPH3 fa...		Lus10012901 [exp]	5.5	0.9774
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Lus10036062 [exp]	5.8	0.9695
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10021904 [exp]	6.9	0.9737
AT1G04220		KCS2	3-ketoacyl-CoA synthase 2 (.1)		Lus10039399 [exp]	7.9	0.9744

Compare expression of checked genes

Lus10024615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.