Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032255 [exp] 127 / 4e-37 AT5G02930 85 / 6e-18 F-box/RNI-like superfamily protein (.1) Lus10020292 [exp] 72 / 3e-16 AT1G60410 76 / 9e-15 F-box family protein (.1) Lus10008296 [exp] 61 / 9e-14 ND / Lus10038935 [exp] 61 / 1e-12 AT1G60400 64 / 3e-11 F-box/RNI-like superfamily protein (.1) Lus10006513 [exp] 49 / 3e-08 AT5G02930 80 / 3e-16 F-box/RNI-like superfamily protein (.1) Lus10024689 [exp] 49 / 4e-08 AT5G42700 97 / 6e-23 AP2/B3-like transcriptional factor family protein (.1) Lus10032309 [exp] 44 / 2e-06 AT2G46150 65 / 7e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10022007 [exp] 43 / 5e-06 AT2G14045 126 / 3e-36 unknown protein Lus10029433 [exp] 43 / 5e-06 AT3G18150 79 / 8e-16 RNI-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024618 pacid=23161534 polypeptide=Lus10024618 locus=Lus10024618.g ID=Lus10024618.BGIv1.0 annot-version=v1.0 ATGGGTTGCATAATGTACAATCGCTCAGACTTCCGGTTTGGCTCCTTTGAGTTTCTGACGCGGACTTGTAATATGGTGAAACCTCAACCTTCTCCTTTCA AGCGAATGAACTTTCTGAGGTTGCGGTATCTTGACGAAATTTCTAGCCTGCCTTATCAAGTGATCCGTTACTATCTTAAAGGCTCTTCTAATGACGAAGA GAAACGTTTTACAGTTGAGAAGGTACGTCGTTAG
AA sequence Show only first row Show all	>Lus10024618 pacid=23161534 polypeptide=Lus10024618 locus=Lus10024618.g ID=Lus10024618.BGIv1.0 annot-version=v1.0 MGCIMYNRSDFRFGSFEFLTRTCNMVKPQPSPFKRMNFLRLRYLDEISSLPYQVIRYYLKGSSNDEEKRFTVEKVRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024618 [exp]	0	1
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10000190 [exp]	1.0	0.9791
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10010341 [exp]	1.4	0.9604
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10042999 [exp]	3.2	0.9139
AT1G63990		SPO11-2	sporulation 11-2 (.1)		Lus10024675 [exp]	4.2	0.9320
					Lus10010697 [exp]	4.6	0.9546
					Lus10025954 [exp]	5.3	0.8509
AT4G13230			Late embryogenesis abundant pr...		Lus10022822 [exp]	5.3	0.9546
AT5G20610			unknown protein		Lus10025003 [exp]	5.9	0.9546
					Lus10008327 [exp]	6.5	0.9546
AT2G27110	FAR1_related	FRS3	FAR1-related sequence 3 (.1.2....		Lus10008762 [exp]	7.0	0.9546

Compare expression of checked genes

Lus10024618 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.