Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 106 / 7e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 106 / 7e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 103 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 103 / 2e-28 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 100 / 3e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 99 / 4e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 100 / 8e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 98 / 1e-26 ELP extensin-like protein (.1) AT4G12470 98 / 2e-26 AZI1 azelaic acid induced 1 (.1) AT4G12550 96 / 3e-26 AIR1 Auxin-Induced in Root cultures 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032256 [exp] 162 / 4e-50 AT4G12490 102 / 4e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 119 / 1e-34 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 117 / 3e-34 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 117 / 2e-33 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 114 / 4e-33 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 114 / 7e-33 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 114 / 7e-33 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024621 [exp] 115 / 1e-32 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 112 / 3e-32 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 112 / 3e-32 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 110 / 1e-31 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 108 / 1e-30 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 96 / 5e-26 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 92 / 1e-24 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 89 / 4e-23 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 89 / 5e-23 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G008500 [exp] 83 / 3e-20 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 81 / 3e-19 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 79 / 4e-18 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10024619 pacid=23161555 polypeptide=Lus10024619 locus=Lus10024619.g ID=Lus10024619.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAACAAACTCAAACTTGGCTCTCATCCTTGCACTCAACATTCTCTTCTTCTCCATGGTCTCCGGGAACCCAAACCCTACACCAACACCTA GTAACCCAAACCCTAAGCCAACATCTATTTCTAGTCCAATATGGAAACCAAACCCTTCACCAACACCTACTAACCCGAACTCGAACCCAACACCCGCACC TTGTCCAACACCTGCTAATCCTAACCCTACGCCAACTCCCAGCCCTTCGAGTGGGAAATGCCCTGTTAATGTACTCAAGTTCGGCGTTTGTGGAAATCTA CTCAACATCGGGAATAGGAACGCACCGGTTCGACCTTGTTGTAGTTTGATCAATGGACTTGTTGATCTTGATGCCGCTGTTTGCTTTTGCACTGCCATCA AAGCCAACATTCTCGGCTTCAACATCAATCTTCCGGTTTCTTTCAGCTTGCTTCTCAATGCCTGCGGCAAGAGTGCTCCGTCTGGCTTCCAGTGTTCTTA A
AA sequence Show only first row Show all	>Lus10024619 pacid=23161555 polypeptide=Lus10024619 locus=Lus10024619.g ID=Lus10024619.BGIv1.0 annot-version=v1.0 MASKTNSNLALILALNILFFSMVSGNPNPTPTPSNPNPKPTSISSPIWKPNPSPTPTNPNSNPTPAPCPTPANPNPTPTPSPSSGKCPVNVLKFGVCGNL LNIGNRNAPVRPCCSLINGLVDLDAAVCFCTAIKANILGFNINLPVSFSLLLNACGKSAPSGFQCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10024619 [exp]	0	1
AT4G29530			Pyridoxal phosphate phosphatas...		Lus10008573 [exp]	6.6	0.6936
AT5G20810			SAUR-like auxin-responsive pro...		Lus10034888 [exp]	8.5	0.6561
AT1G11340			S-locus lectin protein kinase ...		Lus10007601 [exp]	11.7	0.6717
AT4G30770			Putative membrane lipoprotein ...		Lus10037695 [exp]	12.4	0.6626
AT1G04380			2-oxoglutarate (2OG) and Fe(II...		Lus10009240 [exp]	21.4	0.6329
AT3G58140			phenylalanyl-tRNA synthetase c...		Lus10028547 [exp]	22.0	0.6245
AT1G16760			Protein kinase protein with ad...		Lus10033340 [exp]	23.7	0.6332
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Lus10033389 [exp]	24.2	0.5552
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031236 [exp]	30.0	0.6216
AT2G20540		MEF21	mitochondrial editing factor ...		Lus10007684 [exp]	30.2	0.4985

Compare expression of checked genes

Lus10024619 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.