Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12480 129 / 2e-38 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 127 / 4e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 125 / 1e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 125 / 1e-36 AZI1 azelaic acid induced 1 (.1) AT1G62510 124 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 123 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 123 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 115 / 5e-33 ELP extensin-like protein (.1) AT2G45180 114 / 6e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 105 / 2e-29 AIR1 Auxin-Induced in Root cultures 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024621 [exp] 166 / 3e-52 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 162 / 2e-51 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 139 / 2e-42 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 136 / 6e-41 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 134 / 2e-40 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 133 / 5e-40 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10028929 [exp] 132 / 9e-40 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 128 / 5e-38 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 125 / 3e-37 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 130 / 4e-39 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 129 / 2e-38 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 125 / 3e-37 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 103 / 9e-29 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 103 / 2e-28 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 100 / 2e-27 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008300 [exp] 96 / 2e-24 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 94 / 3e-24 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.001G122100 [exp] 94 / 2e-23 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 88 / 2e-22 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10024620 pacid=23161607 polypeptide=Lus10024620 locus=Lus10024620.g ID=Lus10024620.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAGCAAACTCAACCTTGGCTCTATACCTTGCACTCAACCTTTTCTTCTTCTCCGTGGTCTCTGCGCATTGCGGAGGTGGTTGCCCTACTC CGAACCCAAACCCCAAACCAACACCTACTCCTAACCCGAACCCAAACCCCACACCAACTCCCGCTAACCCAAACCCAAACCCTACACCAACTCCTACTAA CCCGAACCCTACACCCACACCAACTCCTGCTAACCCAAACCCAACACCGACACCTACAAACCCAAACCCTACACCAACACCTAGCACTTCAGGTGGGAAA TGCCCCATTGATGCACTCAAGTTGGGCGTATGTGCTGATGTCCTTAGCAATTTGCTCAATATCAAGATCGGGAGCACACCGGTTCAACCTTGTTGTAGCT TACTCAATGGACTTGCTGATCTTGATGCATCTGTATGCCTTTGCACTGCCATCAAAGCCAACATTCTCGGCATCAATCTCAACGTCCCAATTTCCCTCAG CTTGCTTCTCAATGCTTGCGACAAGAATGCTGCATCTGGCTTCCAGTGCTCTTAA
AA sequence Show only first row Show all	>Lus10024620 pacid=23161607 polypeptide=Lus10024620 locus=Lus10024620.g ID=Lus10024620.BGIv1.0 annot-version=v1.0 MASKANSTLALYLALNLFFFSVVSAHCGGGCPTPNPNPKPTPTPNPNPNPTPTPANPNPNPTPTPTNPNPTPTPTPANPNPTPTPTNPNPTPTPSTSGGK CPIDALKLGVCADVLSNLLNIKIGSTPVQPCCSLLNGLADLDASVCLCTAIKANILGINLNVPISLSLLLNACDKNAASGFQCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10024620 [exp]	0	1
AT5G67480		ATBT4, BT4	BTB and TAZ domain protein 4 (...		Lus10025196 [exp]	2.6	0.7640
					Lus10011367 [exp]	8.0	0.6475
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10039166 [exp]	9.7	0.6401
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024716 [exp]	11.7	0.7250
					Lus10014735 [exp]	27.5	0.5666
AT2G46640			unknown protein		Lus10005993 [exp]	27.6	0.7068
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10042693 [exp]	28.5	0.6336
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006307 [exp]	28.7	0.6837
AT3G13850	AS2	LBD22	LOB domain-containing protein ...		Lus10013510 [exp]	36.0	0.5709
AT5G21430		NdhU, CRRL	NADH dehydrogenase-like comple...		Lus10011955 [exp]	36.3	0.6563

Compare expression of checked genes

Lus10024620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.