Lus10024622 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62510 54 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G12090 50 / 8e-08 ELP extensin-like protein (.1)
AT4G12510 47 / 4e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12520 47 / 4e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G00165 47 / 4e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT4G12480 47 / 1e-06 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 46 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G45180 45 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12490 46 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G22460 44 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024623 89 / 2e-22 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032257 89 / 3e-22 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032258 89 / 9e-22 AT4G12500 92 / 5e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024620 85 / 9e-21 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024621 84 / 2e-20 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004346 76 / 1e-17 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032259 75 / 1e-17 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10028929 68 / 1e-14 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032260 66 / 9e-14 AT4G12520 155 / 5e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G158400 69 / 6e-15 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 68 / 8e-15 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 67 / 2e-14 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121800 43 / 1e-05 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10024622 pacid=23161586 polypeptide=Lus10024622 locus=Lus10024622.g ID=Lus10024622.BGIv1.0 annot-version=v1.0
ATGGGAAGGTTGAGGTTGATGCCGAGAATGTTGGCTTTAATGGCAGTGCAAAGGCAAACAGAAGCATCGAGATCAGCAAGTCCATTAATCAAGCTACAAC
AAGGTTGTGCCGGTGTGCTTCCAATCCTGATATTGAGCAAATTGCCAAGCACATCAGCACAAACACCCAACTTGAGTGCATCGATGGGGCATTTCCCACT
TGAAGAGCTAGGAGTTGGGGTCGGGTTGGGGTTACTAGGTGTTGGTGTTGGGTTTGTAGGTGTAGGAGTTGGTGTAGGGTTTGGGTTTGTAGGAGTTGGT
GTAGGGTTGGGCTTAGTAGGTACTGTTGGTGTGGGGTTTGGATTCGGGTTCGGAGTAGGTGTTGGTTTAGGGTTTGGGTTCGGAGTAGGGCAACCACCAC
CGCAATGTGCAGAGGCCATCGAGAAGAAGAGAAGGTTGAGTGCAAGGAAGAGAGCCAATGTTGAGTTTGCTTTGGAAGCCATTGGTTTATTTGGAGGATG
GATGTTGAGGTCTGGAAGAAGAGTGCTTGGTGAGTTGAGAAGGAACCATGGGATGGGGGGGTTTATAGGGCTTTAA
AA sequence
>Lus10024622 pacid=23161586 polypeptide=Lus10024622 locus=Lus10024622.g ID=Lus10024622.BGIv1.0 annot-version=v1.0
MGRLRLMPRMLALMAVQRQTEASRSASPLIKLQQGCAGVLPILILSKLPSTSAQTPNLSASMGHFPLEELGVGVGLGLLGVGVGFVGVGVGVGFGFVGVG
VGLGLVGTVGVGFGFGFGVGVGLGFGFGVGQPPPQCAEAIEKKRRLSARKRANVEFALEAIGLFGGWMLRSGRRVLGELRRNHGMGGFIGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024622 0 1
AT5G13920 GRF zinc finger / Zinc knuckle... Lus10020975 17.0 0.6271
AT3G22400 ATLOX5, LOX5 Arabidopsis thaliana lipoxygen... Lus10008041 31.9 0.6597
AT2G31260 ATAPG9, APG9 autophagy 9 (APG9) (.1) Lus10000709 34.5 0.6632
Lus10017763 38.5 0.6523
AT1G11310 PMR2, ATMLO2, M... POWDERY MILDEW RESISTANT 2, MI... Lus10016035 71.4 0.6021
AT1G70870 Polyketide cyclase/dehydrase a... Lus10008931 103.0 0.6195
Lus10040545 119.8 0.6135
AT1G70890 MLP43 MLP-like protein 43 (.1) Lus10012467 175.3 0.6125
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10020250 193.0 0.5936

Lus10024622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.