Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 94 / 4e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 94 / 4e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 94 / 1e-24 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 90 / 5e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 88 / 2e-22 AZI1 azelaic acid induced 1 (.1) AT4G12490 87 / 5e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 86 / 5e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 86 / 5e-22 ELP extensin-like protein (.1) AT4G22460 81 / 6e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 77 / 9e-19 AIR1 Auxin-Induced in Root cultures 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032259 [exp] 107 / 1e-30 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 105 / 1e-29 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 103 / 7e-29 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 103 / 9e-29 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 103 / 1e-28 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 101 / 4e-28 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 100 / 6e-27 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 100 / 8e-27 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024621 [exp] 97 / 1e-25 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G121900 [exp] 89 / 3e-23 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 89 / 5e-23 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 86 / 4e-22 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 72 / 9e-17 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 71 / 3e-16 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 68 / 4e-15 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 71 / 5e-15 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 67 / 1e-14 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008300 [exp] 68 / 2e-14 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 67 / 3e-14 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10024623 pacid=23161582 polypeptide=Lus10024623 locus=Lus10024623.g ID=Lus10024623.BGIv1.0 annot-version=v1.0 ATGGGTTCCAGAACAAACTCATCTTTGGCTCTCTTCCTTGCACTCAACCTTCTCTTCTTCTCTATGGTCTCCGCGAACTGCGGGGGTGGATGCCCTACTC CTAACCCGAACCCGAACCCGAACCCTAAACCTACTCCTACTCCGAACCCGAACCCTACCCCTACACCGACACCTACGAACCCTAGCCCTAACCTGACACC AAGCAGTCCTAGCTCTTCAAGTGGGAAATGCCCCATTGATACACTCAAGTTGGGTGTTTGTGCCAATGTGCTTAGTAATTTGCTCAAGATCAATATTGGC AACCCACCGGTGCAGCCTTGTTGTAGCTTGATCAATGGACTTGTTGATCTTGAGGCGGCTCTTTGCCTGTGCACCGCCATTAAAGCCAACATTCTCGGCA TCAACCTCAACCTTCCGATTTCCCTCAACTTGCTTCTCAATGTTTGCAACAGGAATGCTACGCCCGGCTTTCAGTGCCCTTAG
AA sequence Show only first row Show all	>Lus10024623 pacid=23161582 polypeptide=Lus10024623 locus=Lus10024623.g ID=Lus10024623.BGIv1.0 annot-version=v1.0 MGSRTNSSLALFLALNLLFFSMVSANCGGGCPTPNPNPNPNPKPTPTPNPNPTPTPTPTNPSPNLTPSSPSSSSGKCPIDTLKLGVCANVLSNLLKINIG NPPVQPCCSLINGLVDLEAALCLCTAIKANILGINLNLPISLNLLLNVCNRNATPGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10024623 [exp]	0	1
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	4.4	0.7561
AT2G15220			Plant basic secretory protein ...		Lus10026585 [exp]	5.7	0.6944
AT5G12060			Plant self-incompatibility pro...		Lus10023085 [exp]	6.6	0.7243
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10019435 [exp]	7.9	0.6694
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006693 [exp]	8.1	0.7243
AT5G18460			Protein of Unknown Function (D...		Lus10006861 [exp]	9.4	0.7243
AT2G17030			F-box family protein with a do...		Lus10022619 [exp]	10.5	0.7151
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001036 [exp]	11.0	0.6643
AT2G39730		RCA	rubisco activase (.1.2.3)		Lus10035616 [exp]	11.5	0.7124
					Lus10011218 [exp]	12.4	0.7051

Compare expression of checked genes

Lus10024623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.