Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12480 72 / 7e-17 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 69 / 7e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 68 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 68 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 68 / 1e-15 ELP extensin-like protein (.1) AT4G12470 67 / 4e-15 AZI1 azelaic acid induced 1 (.1) AT4G12490 67 / 7e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 67 / 9e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12545 63 / 6e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G00165 60 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004346 [exp] 74 / 6e-18 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028928 [exp] 73 / 1e-17 AT4G12520 105 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 73 / 2e-17 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 70 / 2e-16 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 68 / 1e-15 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 66 / 1e-14 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 65 / 2e-14 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004347 [exp] 65 / 2e-14 AT4G12520 101 / 7e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 65 / 3e-14 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 67 / 2e-15 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 65 / 2e-14 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 64 / 3e-14 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 53 / 6e-10 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 51 / 3e-09 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.018G025900 [exp] 50 / 6e-09 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 49 / 6e-08 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 47 / 7e-08 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 47 / 2e-07 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 44 / 3e-06 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024624 pacid=23161519 polypeptide=Lus10024624 locus=Lus10024624.g ID=Lus10024624.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCCAAGACCGCAACCGTAACCCTAGCTCTGTTCCTCTCCCTCAACCTTCTCTTCTTCTCCGCGACCAAGGCTACCACATCTTGTGCCCCGG CCAACCTGAATGTGTGCGCCGATTTGCTGGATTCTTTGCTCAAGGTCACGATTAACAAGCCGGACTCTCAGCCATGCTGCTCCCTGATCAACGAAGTCGC TGACCTTGATGCGGCCGTTTGCATTTGTGCTGCCCTTAAAAGCAACCTTCTAGGAGCCCTTGGTCTCGTCGACCTTAACCTCTCGGTTAAGGTGCTCCTC AATCAATGTGAGAAGAGTGTCCCTGCCGGCTATCTTTGCTACTAA
AA sequence Show only first row Show all	>Lus10024624 pacid=23161519 polypeptide=Lus10024624 locus=Lus10024624.g ID=Lus10024624.BGIv1.0 annot-version=v1.0 MASSKTATVTLALFLSLNLLFFSATKATTSCAPANLNVCADLLDSLLKVTINKPDSQPCCSLINEVADLDAAVCICAALKSNLLGALGLVDLNLSVKVLL NQCEKSVPAGYLCY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12545			Bifunctional inhibitor/lipid-t...		Lus10024624 [exp]	0	1
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10035629 [exp]	2.8	0.9371
AT4G16260			Glycosyl hydrolase superfamily...		Lus10016883 [exp]	3.0	0.9598
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10037209 [exp]	4.9	0.9378
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10019183 [exp]	5.7	0.9416
AT1G73990		SPPA1, SPPA	signal peptide peptidase (.1)		Lus10013333 [exp]	7.1	0.9089
AT3G49601			unknown protein		Lus10034691 [exp]	8.1	0.9004
AT1G22430			GroES-like zinc-binding dehydr...		Lus10004785 [exp]	8.5	0.9306
AT2G36780			UDP-Glycosyltransferase superf...		Lus10027739 [exp]	8.9	0.9094
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10001589 [exp]	9.7	0.9025
AT1G73990		SPPA1, SPPA	signal peptide peptidase (.1)		Lus10013332 [exp]	10.7	0.9362

Compare expression of checked genes

Lus10024624 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.