Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12090 95 / 1e-25 ELP extensin-like protein (.1) AT1G62510 90 / 7e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 87 / 5e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 87 / 5e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 86 / 7e-22 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 82 / 1e-20 AZI1 azelaic acid induced 1 (.1) AT4G12500 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 80 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 76 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 73 / 2e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024626 [exp] 100 / 5e-28 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032260 [exp] 100 / 1e-27 AT4G12520 155 / 5e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 99 / 3e-27 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 98 / 5e-27 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 96 / 5e-26 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 96 / 5e-26 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 94 / 3e-25 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 90 / 4e-24 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 86 / 3e-22 ND 139 / 2e-43
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 87 / 1e-22 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 84 / 1e-21 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 82 / 5e-21 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 74 / 8e-18 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 73 / 1e-17 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 72 / 5e-17 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 70 / 3e-16 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G008500 [exp] 64 / 1e-13 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 64 / 3e-13 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 62 / 5e-13 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10024625 pacid=23161585 polypeptide=Lus10024625 locus=Lus10024625.g ID=Lus10024625.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAACCAACTCAGCCATGGCTCTCTTCCTTGCACTCAACCTCCTCTTCTTCTCCATGGCATCCGCCTGCGGTGGCGGATGCCCTACCCCGA AACCCAAACCCAAACCCAAACCTAAACCCACTCCTTCAGGAGGAGGGAAATGCCCTGTCGATACCCTGAAACTGGGCGCGTGTGCCAACGTGCTTGGCTC ATTGCTCAATCTTAACCTTGGGAAGCCACCGGTCGAGCCTTGTTGTAGCTTGCTCAATGGACTTGTTGATCTTGAGGCTGCTGTCTGCCTTTGCACCGCC ATTAAAGCCAACATTCTTGGAATCAACCTTAACGTTCCGGTTTCTCTCAGCTTGCTTCTCGACGTTTGTAGCAAGAAGACTCCGCCTGGCTTCCAGTGCC CTTGA
AA sequence Show only first row Show all	>Lus10024625 pacid=23161585 polypeptide=Lus10024625 locus=Lus10024625.g ID=Lus10024625.BGIv1.0 annot-version=v1.0 MASKTNSAMALFLALNLLFFSMASACGGGCPTPKPKPKPKPKPTPSGGGKCPVDTLKLGACANVLGSLLNLNLGKPPVEPCCSLLNGLVDLEAAVCLCTA IKANILGINLNVPVSLSLLLDVCSKKTPPGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024625 [exp]	0	1
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032260 [exp]	2.8	0.8771
AT4G25330			unknown protein		Lus10006358 [exp]	9.7	0.8533
AT1G47740			PPPDE putative thiol peptidase...		Lus10011291 [exp]	11.9	0.8803
AT3G08030			Protein of unknown function, D...		Lus10039602 [exp]	14.4	0.8807
AT5G15140			Galactose mutarotase-like supe...		Lus10005251 [exp]	15.4	0.8796
AT4G01330			Protein kinase superfamily pro...		Lus10041593 [exp]	20.3	0.8696
AT1G54730			Major facilitator superfamily ...		Lus10029963 [exp]	25.4	0.8298
AT3G07010			Pectin lyase-like superfamily ...		Lus10011885 [exp]	34.1	0.8770
AT3G59090			unknown protein		Lus10004930 [exp]	34.6	0.8532
AT3G15115			unknown protein		Lus10013678 [exp]	36.9	0.8320

Compare expression of checked genes

Lus10024625 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.