Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12480 110 / 3e-31 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 108 / 5e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 105 / 9e-30 AZI1 azelaic acid induced 1 (.1) AT1G12090 103 / 6e-29 ELP extensin-like protein (.1) AT4G12500 103 / 8e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 102 / 9e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 102 / 9e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 102 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G22460 86 / 2e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032261 [exp] 134 / 5e-41 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 117 / 2e-34 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 114 / 3e-33 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 114 / 4e-33 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 108 / 2e-31 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 109 / 3e-31 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 102 / 3e-28 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 102 / 4e-28 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024621 [exp] 99 / 7e-27 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G121900 [exp] 108 / 3e-31 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 107 / 1e-30 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 105 / 6e-30 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 86 / 2e-22 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 82 / 4e-21 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 82 / 6e-21 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 81 / 2e-20 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 72 / 1e-16 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 70 / 1e-15 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.001G122100 [exp] 71 / 2e-15 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10024626 pacid=23161665 polypeptide=Lus10024626 locus=Lus10024626.g ID=Lus10024626.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAACCCACTCAACTTTGGCCATTTTCCTAGCCATCAACCTCCTCTTCTTCACCATGGTCTCCGCCACCAAAAAACCAGGCTGCCCACCGC CGCCACCTAAGCCAACCAAATGCCCGCCACCCCCCTCAAAACCCACCCCGACTCCTAGCCCTTCGTCCAACAAATGTCCCGTCGATGCCCTCAAGTTGGG CGTCTGCGCCAATGTGCTTAGCTCGCTTCTCAACATCACGATCGGAAAGCCACCCGTTAAGCCCTGCTGCAGCTTGATCAACGGGCTTGTCGATCTCGAG GCTGCTCTCTGCCTATGCACTGCAATCAAAGCCAACATTCTCGGGATCCACCTCAACGTCCCGGTTTCTCTCAGCTTGCTTCTCAACGTGTGTAACAAGA AGGTCCCATCCGGCTTCCAGTGCCCTTGA
AA sequence Show only first row Show all	>Lus10024626 pacid=23161665 polypeptide=Lus10024626 locus=Lus10024626.g ID=Lus10024626.BGIv1.0 annot-version=v1.0 MASKTHSTLAIFLAINLLFFTMVSATKKPGCPPPPPKPTKCPPPPSKPTPTPSPSSNKCPVDALKLGVCANVLSSLLNITIGKPPVKPCCSLINGLVDLE AALCLCTAIKANILGIHLNVPVSLSLLLNVCNKKVPSGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024626 [exp]	0	1
AT2G01900			DNAse I-like superfamily prote...		Lus10031310 [exp]	1.4	0.9704
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10017285 [exp]	1.4	0.9740
AT5G06490			RING/U-box superfamily protein...		Lus10008972 [exp]	2.2	0.9667
AT1G55210			Disease resistance-responsive ...		Lus10017228 [exp]	3.2	0.9632
AT5G49040			Disease resistance-responsive ...		Lus10021082 [exp]	3.6	0.9618
AT1G04220		KCS2	3-ketoacyl-CoA synthase 2 (.1)		Lus10039399 [exp]	6.0	0.9702
AT3G19850			Phototropic-responsive NPH3 fa...		Lus10012901 [exp]	7.2	0.9695
AT4G24730			Calcineurin-like metallo-phosp...		Lus10017960 [exp]	8.4	0.9294
AT3G60870	AT-hook	AHL18	AT-hook motif nuclear-localize...		Lus10009301 [exp]	10.2	0.9642
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10039806 [exp]	10.8	0.9632

Compare expression of checked genes

Lus10024626 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.