Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 126 / 3e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 126 / 3e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 118 / 8e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 114 / 5e-33 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 111 / 2e-32 ELP extensin-like protein (.1) AT4G12470 112 / 3e-32 AZI1 azelaic acid induced 1 (.1) AT4G12500 110 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 110 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G00165 104 / 8e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032263 [exp] 170 / 2e-55 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032254 [exp] 122 / 2e-36 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 122 / 2e-36 ND 139 / 2e-43 Lus10024616 [exp] 121 / 4e-36 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 121 / 1e-35 ND 139 / 6e-43 Lus10024626 [exp] 119 / 3e-35 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 119 / 4e-35 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 118 / 8e-35 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 117 / 1e-34 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 120 / 1e-35 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 114 / 1e-33 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 113 / 4e-33 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 109 / 1e-31 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 103 / 1e-29 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 100 / 2e-28 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 97 / 1e-26 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 93 / 4e-25 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 93 / 1e-24 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 93 / 4e-24 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10024627 pacid=23161639 polypeptide=Lus10024627 locus=Lus10024627.g ID=Lus10024627.BGIv1.0 annot-version=v1.0 ATGGCTTCAAGATCAGCTACTACCTCAGCTGCTCTCTTCGTAGCCCTGAACCTCCTTTTCTTCACTCTCGTGAGCTCGACCTCCTCTTGCCCTCCGCCCA GCTCGACGCCTGTGCCCGAGGGACACCACAAGCACCATGGCCACAAGCACCCGACGAAGTGCCCTAGGGACACCTTGAAGTTGGGTGTATGTGCCAACGT GTTGAATGACCTTGTCCACCTTGTGGTGGGTACTCCCGCGACGCATCCCTGTTGTTCGCTCTTGGGGAGCATGGTGGATCTTGAGGCCGCTGTCTGCCTT TGCACTGCTCTTAAAGCTGACGTCCTGGGGATGCACCTTAACATCCCTATCGCGATGACCCTACTCCTCAACGTGTGTGGGAAGTCGGCCCCGGAAGGGT TCACTTGTGCTTGA
AA sequence Show only first row Show all	>Lus10024627 pacid=23161639 polypeptide=Lus10024627 locus=Lus10024627.g ID=Lus10024627.BGIv1.0 annot-version=v1.0 MASRSATTSAALFVALNLLFFTLVSSTSSCPPPSSTPVPEGHHKHHGHKHPTKCPRDTLKLGVCANVLNDLVHLVVGTPATHPCCSLLGSMVDLEAAVCL CTALKADVLGMHLNIPIAMTLLLNVCGKSAPEGFTCA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024627 [exp]	0	1
AT3G15850		JB67, FADB, ADS...	FATTY ACID DESATURASE B, fatty...		Lus10001279 [exp]	10.1	0.9980
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032263 [exp]	14.4	0.9980
					Lus10028932 [exp]	17.7	0.9978
AT3G21720		ICL	isocitrate lyase (.1)		Lus10031552 [exp]	20.4	0.9978
AT5G14570		ATNRT2.7	high affinity nitrate transpor...		Lus10008767 [exp]	21.3	0.9791
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	22.7	0.9978
AT1G65090			unknown protein		Lus10020377 [exp]	23.7	0.9836
					Lus10016593 [exp]	24.9	0.9978
AT2G38500			2-oxoglutarate (2OG) and Fe(II...		Lus10006093 [exp]	26.9	0.9978
AT1G26945	bHLH	KDR, PRE6	KIDARI, basic helix-loop-helix...		Lus10036732 [exp]	27.8	0.9775

Compare expression of checked genes

Lus10024627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.