Lus10024634 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78190 169 / 2e-55 Trm112p-like protein (.1)
AT1G22270 136 / 1e-42 Trm112p-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032269 202 / 2e-68 AT1G78190 186 / 3e-62 Trm112p-like protein (.1)
Lus10017505 181 / 2e-60 AT1G78190 175 / 6e-58 Trm112p-like protein (.1)
Lus10028778 164 / 5e-48 AT5G45140 1711 / 0.0 nuclear RNA polymerase C2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G165000 172 / 7e-57 AT1G22270 165 / 4e-54 Trm112p-like protein (.1)
Potri.002G096600 147 / 4e-47 AT1G22270 169 / 2e-55 Trm112p-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF03966 Trm112p Trm112p-like protein
Representative CDS sequence
>Lus10024634 pacid=23161564 polypeptide=Lus10024634 locus=Lus10024634.g ID=Lus10024634.BGIv1.0 annot-version=v1.0
ATGAGGCTACTGACTCACAACATGCTCTCCTCCAACATCAAGGGAGTCGTCAACGGGTTCCCGCTCCGGATCGAGGCGGAGAAAGTGGTCGAGAAGGAAG
TCGATCTCAACCCCGACTTCCTCCGCAACATCTTCCACAAGATCGAGTGGAAGCCGCTCGCCGAAGCCGCGCGTGCCGTCGGGTACTCGGAGCTCCCGGA
GGCGGCGGAGGAGTCGATGCTGGAATCGGAGGAGTTCCTGGGGAAGTTCCACCACGCGCTGCTGGAGATCCACTTGGAGGAAGGGGCTCTGGTCTGCCCC
GAGACTGGGCGGAAGTTCTCCGTTAGCAAAGGGATCCCCAATATGCTCCTCCACGAGGATGAGGTTTAG
AA sequence
>Lus10024634 pacid=23161564 polypeptide=Lus10024634 locus=Lus10024634.g ID=Lus10024634.BGIv1.0 annot-version=v1.0
MRLLTHNMLSSNIKGVVNGFPLRIEAEKVVEKEVDLNPDFLRNIFHKIEWKPLAEAARAVGYSELPEAAEESMLESEEFLGKFHHALLEIHLEEGALVCP
ETGRKFSVSKGIPNMLLHEDEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78190 Trm112p-like protein (.1) Lus10024634 0 1
AT2G29380 HAI3 highly ABA-induced PP2C gene 3... Lus10003887 4.6 0.7688
AT1G28360 AP2_ERF AtERF12 ERF domain protein 12 (.1) Lus10013993 7.6 0.7579
AT1G78190 Trm112p-like protein (.1) Lus10032269 7.7 0.6920
AT4G13270 Late embryogenesis abundant (L... Lus10024264 8.1 0.7406
AT3G24860 Trihelix Homeodomain-like superfamily p... Lus10022789 12.1 0.7104
AT5G44170 S-adenosyl-L-methionine-depend... Lus10018640 13.4 0.7235
AT1G28280 VQ motif-containing protein (.... Lus10025443 15.5 0.6098
AT3G47620 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea ... Lus10013814 15.6 0.7238
AT2G47990 SWA1, EDA13, ED... SLOW WALKER1, EMBRYO SAC DEVEL... Lus10017890 18.0 0.7144
AT4G13270 Late embryogenesis abundant (L... Lus10023631 22.2 0.7053

Lus10024634 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.