Lus10024638 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G63800 214 / 4e-71 UBC5 ubiquitin-conjugating enzyme 5 (.1)
AT5G41340 212 / 2e-70 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1)
AT2G46030 203 / 4e-67 UBC6 ubiquitin-conjugating enzyme 6 (.1)
AT3G08690 87 / 7e-22 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT1G64230 86 / 1e-21 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G41700 86 / 3e-21 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G56150 85 / 5e-21 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT4G27960 84 / 8e-21 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G53300 84 / 9e-21 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT3G08700 84 / 1e-20 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032274 264 / 3e-91 AT1G63800 278 / 5e-97 ubiquitin-conjugating enzyme 5 (.1)
Lus10014763 218 / 7e-73 AT1G63800 294 / 6e-103 ubiquitin-conjugating enzyme 5 (.1)
Lus10042136 208 / 4e-69 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1)
Lus10036372 207 / 1e-68 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1)
Lus10002359 207 / 4e-68 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1)
Lus10014187 86 / 2e-21 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 86 / 2e-21 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 86 / 2e-21 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 86 / 2e-21 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G101900 246 / 7e-84 AT5G41340 292 / 3e-102 ubiquitin conjugating enzyme 4 (.1)
Potri.003G129700 237 / 2e-80 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1)
Potri.002G161000 234 / 2e-79 AT1G63800 288 / 1e-100 ubiquitin-conjugating enzyme 5 (.1)
Potri.014G086600 230 / 1e-77 AT1G63800 283 / 8e-99 ubiquitin-conjugating enzyme 5 (.1)
Potri.015G073400 209 / 3e-69 AT5G41340 268 / 1e-92 ubiquitin conjugating enzyme 4 (.1)
Potri.019G083800 90 / 6e-23 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.012G104100 87 / 2e-21 AT5G50870 334 / 1e-118 ubiquitin-conjugating enzyme 27 (.1.2)
Potri.001G094900 86 / 2e-21 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 86 / 2e-21 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 86 / 2e-21 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10024638 pacid=23161595 polypeptide=Lus10024638 locus=Lus10024638.g ID=Lus10024638.BGIv1.0 annot-version=v1.0
ATGGAACAAGGCTTTGAGGAAGGCTCCGGTCTAGCTGATCGACCGGAAACAATGATCAGCGAGACTGGGGCTATCAAGAAGCTGACGAGGGAGTTTGATT
CCCTTGGCGACATTAAGTCTCCAATTACGACCTTGGCCTCAAACCGCTATTGTCCTTACCAAGAAGGAATGTGGAAGATACGAGTGGAATTACCAGATGC
TTATCCTTATAAGTCTCCATCCATTGGATTTATTAACAAGATCTACCACCCAAACGTGGATGAAATGTCCGGTTCGGTTTGCTTGGATGTTATCAATCAA
ACTTGGAGCCCGATGTTCGATTTGGTGAATGTGTTTGAAGTGTTTCTTCCTCAGCTTCTTTTGTACCCCAATCCGTCGGATCCTTTGAATGGAGAAGCTG
CTGCTTTGATGATGCGTGATCGTACTGCTTATGACCAAAGAGTGAAAGAGTATTGCGAAAAGTATGCGAGGCCGGAGGACGTTGGGGCGAAACCAGAAGA
TGAATCGAGTGACGAGGAGCTGAGTGAAGCTGATGAATATGGCTCTGAGGATGATCAAATTGCAGGGAAAGCTGATCCCTGA
AA sequence
>Lus10024638 pacid=23161595 polypeptide=Lus10024638 locus=Lus10024638.g ID=Lus10024638.BGIv1.0 annot-version=v1.0
MEQGFEEGSGLADRPETMISETGAIKKLTREFDSLGDIKSPITTLASNRYCPYQEGMWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQ
TWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYDQRVKEYCEKYARPEDVGAKPEDESSDEELSEADEYGSEDDQIAGKADP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G63800 UBC5 ubiquitin-conjugating enzyme 5... Lus10024638 0 1
AT3G50360 CEN1, ATCEN2 CENTRIN 1, centrin2 (.1) Lus10009353 2.8 0.8655
AT5G09260 VPS20.2 vacuolar protein sorting-assoc... Lus10037699 5.3 0.8824
AT4G32960 unknown protein Lus10007456 9.8 0.8768
AT2G37480 unknown protein Lus10023755 10.8 0.8816
AT1G63800 UBC5 ubiquitin-conjugating enzyme 5... Lus10032274 11.6 0.8871
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10035419 12.0 0.8348
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10037992 13.4 0.8672
AT3G13970 APG12B, APG12 AUTOPHAGY 12 B, AUTOPHAGY 12, ... Lus10000432 16.1 0.8656
AT1G78680 ATGGH2 gamma-glutamyl hydrolase 2 (.1... Lus10028143 19.1 0.8186
AT1G55915 zinc ion binding (.1) Lus10035762 19.9 0.8101

Lus10024638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.