Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11410 81 / 1e-19 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G02540 71 / 1e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G23420 70 / 2e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT4G23430 68 / 1e-14 AtTic32-IVa translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT2G37540 66 / 4e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G24050 52 / 5e-09 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G50130 49 / 4e-08 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT1G64590 45 / 2e-06 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G20480 37 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032280 [exp] 136 / 1e-39 AT4G11410 461 / 5e-163 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10028781 [exp] 94 / 2e-24 AT4G11410 470 / 3e-168 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10035481 [exp] 76 / 2e-17 AT4G23430 479 / 6e-172 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10031101 [exp] 75 / 2e-17 AT4G23430 478 / 1e-171 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10038857 [exp] 75 / 4e-17 AT4G23430 436 / 2e-154 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10014975 [exp] 75 / 5e-17 AT4G23430 442 / 8e-157 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10025321 [exp] 67 / 2e-14 AT5G02540 412 / 1e-145 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024415 [exp] 67 / 3e-14 AT5G02540 471 / 4e-168 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024647 [exp] 66 / 9e-14 AT4G11410 461 / 1e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G128700 [exp] 80 / 5e-19 AT4G11410 497 / 4e-179 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G103000 [exp] 79 / 6e-19 AT4G11410 446 / 4e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.003G128800 [exp] 79 / 9e-19 AT4G23420 442 / 5e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.012G143600 [exp] 70 / 3e-15 AT4G23430 401 / 2e-140 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.006G083900 [exp] 69 / 3e-15 AT5G02540 452 / 3e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.015G146600 [exp] 68 / 7e-15 AT4G23420 444 / 6e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.012G143800 [exp] 64 / 2e-13 AT4G23420 427 / 3e-151 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.015G081102 [exp] 55 / 4e-10 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.T124508 [exp] 55 / 4e-10 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.012G087800 [exp] 54 / 1e-09 AT5G50130 426 / 4e-150 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024646 pacid=23161573 polypeptide=Lus10024646 locus=Lus10024646.g ID=Lus10024646.BGIv1.0 annot-version=v1.0 ATGAAAGGAAGCGGCAGATCATCACCGTCGCCGGTGATCGGAGTCGGCAAACCTCCTTTCAGGCCTGCACAAGACGATACTAAGCCTCCACTCCAAGACC CAGGAGCTGCTACTAGCTGTTATCTGGCGCTGCACCCTCAAGTTAAAGGTGTAACTGGTAAACACTTCATGGACTGTAACCTGGCCGAACCAAATTCGCA TGGGAATGATATGGATTTGGCAAAGAAGTTTTGGGAGTTCAGCTGGAGCTTGACTTCCAGTCATGTAAAAGTAATTTCAAACCGGGTAGTGTTTCCGGAA CACATTTAA
AA sequence Show only first row Show all	>Lus10024646 pacid=23161573 polypeptide=Lus10024646 locus=Lus10024646.g ID=Lus10024646.BGIv1.0 annot-version=v1.0 MKGSGRSSPSPVIGVGKPPFRPAQDDTKPPLQDPGAATSCYLALHPQVKGVTGKHFMDCNLAEPNSHGNDMDLAKKFWEFSWSLTSSHVKVISNRVVFPE HI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10024646 [exp]	0	1
					Lus10004923 [exp]	38.5	0.7774
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Lus10021934 [exp]	50.4	0.7668
AT5G49600			Protein of unknown function, D...		Lus10017087 [exp]	53.3	0.7671
AT1G23890			NHL domain-containing protein ...		Lus10030849 [exp]	58.9	0.6989
AT1G73450			Protein kinase superfamily pro...		Lus10031328 [exp]	72.0	0.7263
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10028748 [exp]	88.2	0.7578
AT1G12790			unknown protein		Lus10003529 [exp]	93.2	0.6956
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10029103 [exp]	94.8	0.7593
AT5G13020		AtEML3, ACK1	EMSY-like 3, Emsy N Terminus (...		Lus10031799 [exp]	104.7	0.7371
AT5G63135			unknown protein		Lus10019491 [exp]	135.1	0.7524

Compare expression of checked genes

Lus10024646 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.