Lus10024661 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41410 46 / 1e-06 HD BEL1 BELL 1, POX (plant homeobox) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032292 135 / 1e-38 AT5G41410 309 / 6e-98 BELL 1, POX (plant homeobox) family protein (.1)
Lus10028770 47 / 5e-07 AT5G41410 344 / 2e-110 BELL 1, POX (plant homeobox) family protein (.1)
Lus10017513 38 / 0.0005 AT5G41410 340 / 1e-108 BELL 1, POX (plant homeobox) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G100800 61 / 4e-12 AT5G41410 440 / 4e-147 BELL 1, POX (plant homeobox) family protein (.1)
Potri.003G131300 57 / 1e-10 AT5G41410 434 / 2e-144 BELL 1, POX (plant homeobox) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10024661 pacid=23161518 polypeptide=Lus10024661 locus=Lus10024661.g ID=Lus10024661.BGIv1.0 annot-version=v1.0
ATGTTTGGCGCGGTGGAGCTCGATTTCTCGTCCTCTAACTACAACCACCACCACCACCATGATCATCAATCTGAGGCCGGGGTTTCGTATGATCATCTCC
ATCAGCAGATGCAAGGTGGCGGCGGGGTGTCATTGACACTAGGGTTGCAACAACATGGTGGTTTGGGAAGCAATAGCATCTTCTTCCAGAGAGATCACCA
TGATCAGGAGGTGCAATACTCTTCAGCCCTTGATGGGTTGGATCAAGGTGGTGGAGTTCAGAATTTGCCTTACAGGAACTTGATGGGTGGCCATCAATTG
CTTCATGACCTAGCTGGATGA
AA sequence
>Lus10024661 pacid=23161518 polypeptide=Lus10024661 locus=Lus10024661.g ID=Lus10024661.BGIv1.0 annot-version=v1.0
MFGAVELDFSSSNYNHHHHHDHQSEAGVSYDHLHQQMQGGGGVSLTLGLQQHGGLGSNSIFFQRDHHDQEVQYSSALDGLDQGGGVQNLPYRNLMGGHQL
LHDLAG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G41410 HD BEL1 BELL 1, POX (plant homeobox) f... Lus10024661 0 1
AT3G50440 ATMES10 ARABIDOPSIS THALIANA METHYL ES... Lus10022467 1.0 0.9133
AT3G02250 O-fucosyltransferase family pr... Lus10036833 1.7 0.8875
AT5G41410 HD BEL1 BELL 1, POX (plant homeobox) f... Lus10032292 2.2 0.8669
AT1G68290 ENDO2 ,ENDO 2 endonuclease 2 (.1) Lus10041437 4.0 0.8271
AT5G17680 disease resistance protein (TI... Lus10041078 5.8 0.8945
AT4G31805 WRKY family transcription fact... Lus10024451 7.9 0.8418
AT2G04220 Plant protein of unknown funct... Lus10027127 8.0 0.8761
AT3G14130 Aldolase-type TIM barrel famil... Lus10013173 8.8 0.8630
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10030934 9.4 0.7784
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Lus10004028 10.2 0.8434

Lus10024661 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.