Lus10024665 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53270 87 / 5e-21 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032295 153 / 2e-44 AT4G01370 572 / 0.0 MAP kinase 4 (.1)
Lus10008478 139 / 1e-40 AT3G53270 273 / 4e-91 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Lus10001478 136 / 5e-39 AT3G53270 294 / 5e-99 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G065800 102 / 1e-26 AT3G53270 292 / 5e-99 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Potri.004G126760 59 / 3e-11 AT3G53270 157 / 2e-48 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Potri.004G126720 56 / 4e-10 AT3G53270 174 / 3e-55 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09808 SNAPc_SNAP43 Small nuclear RNA activating complex (SNAPc), subunit SNAP43
Representative CDS sequence
>Lus10024665 pacid=23161577 polypeptide=Lus10024665 locus=Lus10024665.g ID=Lus10024665.BGIv1.0 annot-version=v1.0
ATGTCCAGCAAGGAACAGTCAACAAGATTTTCAGACCTGAAGAAGATATGGCATTCAAGGAAGTTTTCTTACATTTACGATGCCAACCCTGCTGCAAATT
TCGCTTTCTTTATGCAGTCTCTACATGCTCATACAATTGGCCATATGTATGACACGGCTTCCTTATCAAGAGGATTAGTGGGATTGTATTGCTTGTTAAG
GTTGGAGGATACCGGAGTTGAGCACTTCCTCCACCTGGACATGGCAAAAGAGTTGGATGTAGACAAGTTGAAGAAAGCATCCACAGAATATGCGGAGTTT
AAGAAACATGCAATGGAAGAGGCCAGCAAGGTAGTTAATGTTGAAGATGTTGAGCATCTCGCGAATGACGAGGAACTGATTGTTGACGAAGTGGAGAAAA
TCACAGAGTGTTGGAAAGTCCAGAAGGATCTGTACTACCAACAAGATGATGATGATAATGACAATGAAGATAACGACAACGACAATGAAGATGACAACGA
CGAATATGGTCGTTAG
AA sequence
>Lus10024665 pacid=23161577 polypeptide=Lus10024665 locus=Lus10024665.g ID=Lus10024665.BGIv1.0 annot-version=v1.0
MSSKEQSTRFSDLKKIWHSRKFSYIYDANPAANFAFFMQSLHAHTIGHMYDTASLSRGLVGLYCLLRLEDTGVEHFLHLDMAKELDVDKLKKASTEYAEF
KKHAMEEASKVVNVEDVEHLANDEELIVDEVEKITECWKVQKDLYYQQDDDDNDNEDNDNDNEDDNDEYGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G53270 Small nuclear RNA activating c... Lus10024665 0 1
AT5G41470 Nuclear transport factor 2 (NT... Lus10024664 2.4 0.9143
AT1G05620 NSH2, URH2 nucleoside hydrolase 2, uridin... Lus10022062 5.2 0.9286
AT4G24740 AME1, AFC2 FUS3-complementing gene 2 (.1.... Lus10006230 9.3 0.9177
AT4G10970 unknown protein Lus10023075 9.6 0.9204
Lus10006087 11.1 0.9164
AT1G79610 ATNHX6 Na+/H+ antiporter 6, ARABIDOPS... Lus10039131 12.1 0.9138
AT5G55100 SWAP (Suppressor-of-White-APri... Lus10032646 13.8 0.9144
Lus10040954 28.3 0.8984
AT1G28560 SRD2 SHOOT REDIFFERENTIATION DEFECT... Lus10041957 30.2 0.8979
AT5G36930 Disease resistance protein (TI... Lus10007828 30.8 0.8936

Lus10024665 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.