Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23496 74 / 2e-19 SP1L5 SPIRAL1-like5 (.1) AT1G69230 69 / 4e-17 SP1L2 SPIRAL1-like2 (.1.2) AT2G03680 65 / 1e-15 SKU6, SPR1 spiral1 (.1.2) AT1G26355 63 / 7e-15 SP1L1 SPIRAL1-like1 (.1) AT5G15600 62 / 2e-14 SP1L4 SPIRAL1-like4 (.1) AT3G02180 62 / 4e-14 SP1L3 SPIRAL1-like3 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032297 [exp] 114 / 4e-35 AT1G69230 98 / 7e-28 SPIRAL1-like2 (.1.2) Lus10034675 [exp] 69 / 5e-17 AT1G26355 127 / 5e-39 SPIRAL1-like1 (.1) Lus10032988 [exp] 68 / 2e-16 AT1G69230 99 / 8e-28 SPIRAL1-like2 (.1.2) Lus10037069 [exp] 67 / 3e-16 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1) Lus10036916 [exp] 67 / 3e-16 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10000046 [exp] 67 / 3e-16 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10026670 [exp] 65 / 2e-15 AT1G26355 150 / 1e-48 SPIRAL1-like1 (.1) Lus10026672 [exp] 65 / 2e-15 AT1G26355 149 / 4e-48 SPIRAL1-like1 (.1) Lus10004642 [exp] 63 / 1e-14 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G100100 [exp] 79 / 2e-21 AT4G23496 81 / 2e-21 SPIRAL1-like5 (.1) Potri.003G131600 [exp] 79 / 3e-21 AT4G23496 81 / 4e-21 SPIRAL1-like5 (.1) Potri.010G157600 [exp] 67 / 2e-16 AT1G26355 120 / 1e-36 SPIRAL1-like1 (.1) Potri.008G097000 [exp] 67 / 2e-16 AT1G26355 127 / 2e-39 SPIRAL1-like1 (.1) Potri.017G095200 [exp] 66 / 5e-16 AT1G69230 94 / 2e-26 SPIRAL1-like2 (.1.2) Potri.015G059100 [exp] 58 / 1e-12 AT1G26355 98 / 1e-27 SPIRAL1-like1 (.1) Potri.T124504 [exp] 48 / 3e-08 AT1G19270 182 / 3e-53 DA1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024667 pacid=23161505 polypeptide=Lus10024667 locus=Lus10024667.g ID=Lus10024667.BGIv1.0 annot-version=v1.0 ATGCAGCCTGACGCGCCGCCGTCTACTGATCTGAAGCAAAACGACCGTCAGAAGGCGTCACCGGCGAACAACTACCCTAGGGCTCAGGGCCAGAATTCAG GCAACTTCATCACTGATCGGCCATCGACCAAAGTGAAGTCAGTTCCGGGAGGAGATTCTTCACTGGGATACTTGTTTGGGGATAATTAA
AA sequence Show only first row Show all	>Lus10024667 pacid=23161505 polypeptide=Lus10024667 locus=Lus10024667.g ID=Lus10024667.BGIv1.0 annot-version=v1.0 MQPDAPPSTDLKQNDRQKASPANNYPRAQGQNSGNFITDRPSTKVKSVPGGDSSLGYLFGDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23496		SP1L5	SPIRAL1-like5 (.1)		Lus10024667 [exp]	0	1
AT5G10930		CIPK5, SnRK3.24	SNF1-RELATED PROTEIN KINASE 3....		Lus10041653 [exp]	1.7	0.9567
AT5G63130			Octicosapeptide/Phox/Bem1p fam...		Lus10017947 [exp]	4.9	0.9265
AT2G37900			Major facilitator superfamily ...		Lus10024340 [exp]	6.2	0.9369
AT4G27350			Protein of unknown function (D...		Lus10038565 [exp]	6.5	0.9383
AT2G37740	C2H2ZnF	ATZFP10, ZFP10	zinc-finger protein 10 (.1)		Lus10024875 [exp]	7.1	0.9221
AT1G47410			unknown protein		Lus10009767 [exp]	7.3	0.9342
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10014239 [exp]	7.9	0.9238
AT1G47410			unknown protein		Lus10006481 [exp]	8.0	0.9078
AT3G52060			Core-2/I-branching beta-1,6-N-...		Lus10028866 [exp]	8.2	0.9075
AT3G15480			Protein of unknown function (D...		Lus10043091 [exp]	8.4	0.9343

Compare expression of checked genes

Lus10024667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.