Lus10024670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G63950 47 / 2e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT1G01490 46 / 1e-06 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52740 38 / 0.0006 Copper transport protein family (.1)
AT5G27690 39 / 0.0008 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040691 91 / 1e-23 AT2G29640 75 / 3e-16 JOSEPHIN-like protein (.1)
Lus10027523 57 / 5e-11 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 58 / 1e-10 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10028762 53 / 2e-09 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 54 / 5e-09 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10024672 47 / 3e-07 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027522 45 / 2e-06 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10017520 43 / 7e-06 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007911 44 / 1e-05 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G073000 54 / 4e-10 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 53 / 9e-10 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.001G099500 52 / 4e-09 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 48 / 7e-08 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 48 / 1e-07 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073100 46 / 4e-07 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.014G089700 45 / 2e-06 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G163400 43 / 1e-05 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147300 42 / 1e-05 AT1G01490 87 / 2e-22 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147200 40 / 7e-05 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10024670 pacid=23161648 polypeptide=Lus10024670 locus=Lus10024670.g ID=Lus10024670.BGIv1.0 annot-version=v1.0
ATGATCCTCAAGGTGGAGATCCGCGACGAGAAGCACAAGCTCAAGGTGTTGAAGGCCATCGCGATCCCAGGGATCGTGGGCTCGAACATCGACATGAAGG
AGCAGAAGCTGACCGTATTCGGAGATGTCGACCCGGGGAAAGTGTGGAGGACTCTCAAATGGGTGTGTTTCAGTGCCATCATATCGGTGGAGATGGATTT
CGAGGAGAGGGAACAGGCGGACGAGGAGGCGAGAGTGAAGGAACAAGAAGAGAAGATAAGAGATGAGGTCATGCAGGAAAAATATGGGATGGTTGGTGGT
ATGAATTATTATCATCGGCATCAAATACCCTCGTCGGACTATGTCCAACATTTTCGATACCCCTATCCCGAACCTGTGGTCATAGTAGACGATAGCCCTG
GCTGCGTCGTTATGTGA
AA sequence
>Lus10024670 pacid=23161648 polypeptide=Lus10024670 locus=Lus10024670.g ID=Lus10024670.BGIv1.0 annot-version=v1.0
MILKVEIRDEKHKLKVLKAIAIPGIVGSNIDMKEQKLTVFGDVDPGKVWRTLKWVCFSAIISVEMDFEEREQADEEARVKEQEEKIRDEVMQEKYGMVGG
MNYYHRHQIPSSDYVQHFRYPYPEPVVIVDDSPGCVVM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01490 Heavy metal transport/detoxifi... Lus10024670 0 1
Lus10029617 1.0 0.9564
AT2G23110 Late embryogenesis abundant pr... Lus10029709 6.5 0.9101
Lus10008385 13.7 0.9126
AT5G37820 NIP4;2, NLM5 NODULIN- 26-LIKE MAJOR INTRINS... Lus10025744 16.3 0.8780
AT5G61340 unknown protein Lus10003483 16.7 0.8699
AT3G48360 ATBT2, BT2 BTB and TAZ domain protein 2 (... Lus10018087 19.1 0.8728
AT3G15670 Late embryogenesis abundant pr... Lus10004395 19.7 0.9070
AT3G21690 MATE efflux family protein (.1... Lus10020049 20.1 0.8475
Lus10009393 22.6 0.9067
AT1G19670 CORI1, ATHCOR1,... CORONATINE-INDUCED PROTEIN 1, ... Lus10004076 23.9 0.8565

Lus10024670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.