Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01490 65 / 6e-14 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G52750 53 / 7e-10 Heavy metal transport/detoxification superfamily protein (.1) AT5G23760 49 / 2e-08 Copper transport protein family (.1) AT5G26690 40 / 5e-05 Heavy metal transport/detoxification superfamily protein (.1) AT5G52730 40 / 7e-05 Copper transport protein family (.1) AT3G56891 40 / 0.0001 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028762 [exp] 68 / 2e-15 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 68 / 5e-15 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 67 / 1e-14 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 60 / 2e-11 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 58 / 6e-11 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 57 / 7e-11 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027522 [exp] 53 / 1e-09 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007455 [exp] 53 / 7e-09 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10017520 [exp] 50 / 9e-09 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G073000 [exp] 69 / 5e-16 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 69 / 1e-15 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.001G099500 [exp] 67 / 3e-15 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147500 [exp] 67 / 4e-15 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 68 / 5e-15 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G163400 [exp] 66 / 2e-14 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147400 [exp] 64 / 4e-14 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073100 [exp] 60 / 3e-12 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.012G141500 [exp] 50 / 5e-09 AT5G23760 92 / 1e-25 Copper transport protein family (.1) Potri.015G144200 [exp] 48 / 1e-07 AT5G23760 96 / 2e-26 Copper transport protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10024672 pacid=23161547 polypeptide=Lus10024672 locus=Lus10024672.g ID=Lus10024672.BGIv1.0 annot-version=v1.0 ATGAACAAGAAAATAGTGCTGGGAATCAACATCCACGACGAGAAAGTGAAGCGCAAGGCAATGGAGGCTGTTTCAACCCTTCTAGGTATTGATTTCATCG GGGTCGATATGGATGAACAGAAGATGACGGTAATTGGGTACGTGGATTCTTTTGAAGTGGCGTTGAAACTGAACGAGTGCTGTTCCAATCAGATCCTGTC GGTGGAAACGTTGACCGGAGATCAGCCGGAGAAAGAGGACTTGGATAATGAGACGGTTGAAGATGAAAATTGGGTTGTAACGAACTTTGAAACTGGAATT TATATGGTGATTTTATGTCTCTGTGGCTTTTTGGAGATATATACCATATTTGCCTCCAAAACCAGTTACTTATAG
AA sequence Show only first row Show all	>Lus10024672 pacid=23161547 polypeptide=Lus10024672 locus=Lus10024672.g ID=Lus10024672.BGIv1.0 annot-version=v1.0 MNKKIVLGINIHDEKVKRKAMEAVSTLLGIDFIGVDMDEQKMTVIGYVDSFEVALKLNECCSNQILSVETLTGDQPEKEDLDNETVEDENWVVTNFETGI YMVILCLCGFLEIYTIFASKTSYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01490			Heavy metal transport/detoxifi...		Lus10024672 [exp]	0	1
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10042315 [exp]	1.0	0.8887
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	6.5	0.7625
AT5G17680			disease resistance protein (TI...		Lus10012852 [exp]	8.1	0.7215
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10035526 [exp]	9.7	0.7592
AT1G52540			Protein kinase superfamily pro...		Lus10019988 [exp]	12.5	0.6712
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031238 [exp]	13.0	0.7442
					Lus10007078 [exp]	16.7	0.7212
					Lus10020479 [exp]	17.9	0.6710
AT2G38870			Serine protease inhibitor, pot...		Lus10024870 [exp]	19.4	0.8032
AT4G01575			serine protease inhibitor, Kaz...		Lus10009865 [exp]	20.3	0.6151

Compare expression of checked genes

Lus10024672 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.