Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20480 83 / 2e-19 EFR EF-TU receptor (.1) AT1G34110 81 / 1e-18 Leucine-rich receptor-like protein kinase family protein (.1) AT2G01950 81 / 1e-18 VH1, BRL2 VASCULAR HIGHWAY 1, BRI1-like 2 (.1) AT4G20140 76 / 6e-17 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1) AT2G33170 76 / 6e-17 Leucine-rich repeat receptor-like protein kinase family protein (.1) AT4G36180 76 / 6e-17 Leucine-rich receptor-like protein kinase family protein (.1) AT1G71400 76 / 6e-17 AtRLP12 receptor like protein 12 (.1) AT3G24240 75 / 1e-16 Leucine-rich repeat receptor-like protein kinase family protein (.1) AT5G01890 74 / 2e-16 Leucine-rich receptor-like protein kinase family protein (.1) AT5G62710 74 / 4e-16 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032306 [exp] 173 / 3e-51 AT3G47570 792 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030845 [exp] 154 / 3e-44 AT3G47570 796 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030846 [exp] 145 / 2e-41 AT3G47570 749 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030855 [exp] 144 / 7e-41 AT3G47570 790 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030587 [exp] 139 / 5e-39 AT3G47570 776 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10014500 [exp] 135 / 5e-38 AT3G47570 663 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030638 [exp] 135 / 8e-38 AT3G47570 771 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030856 [exp] 134 / 2e-37 AT3G47570 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030854 [exp] 134 / 2e-37 AT3G47110 758 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G033700 [exp] 94 / 2e-23 AT3G47570 799 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G080000 [exp] 94 / 2e-23 AT3G47570 818 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G007866 [exp] 93 / 6e-23 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G145200 [exp] 92 / 9e-23 AT3G47570 793 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G151400 [exp] 92 / 1e-22 AT3G47570 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G099100 [exp] 90 / 6e-22 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G115900 [exp] 90 / 6e-22 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G152500 [exp] 89 / 1e-21 AT3G47570 753 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G102700 [exp] 89 / 1e-21 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228300 [exp] 89 / 1e-21 AT3G47570 743 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10024681 pacid=23161669 polypeptide=Lus10024681 locus=Lus10024681.g ID=Lus10024681.BGIv1.0 annot-version=v1.0 ATGTTCGTTGGGGGAATCCCTCCTGAAATCGGCCGCCTTCATAGATTGCAAAAGCCGGTGCTTAACAACAACTCACTTGGCGGTGAAATCCCACCCAACA TCTCAGGATGCTCTGCTCAAACTGTTTTGCAGGTAAAACGAAACAAGCTGGTGGGTGGACTTCCATGGCAGATTGGCCTGTTGAACAAACTCCAATACTT TTCTGTAAGTGTAAACAACTTGAGTGGAAGCATCCCGCCTTCTTTTGGAAACCTATCATCTCTTCAAGAGTTCCGAGCAGCTACACATCAAATGAGTGGG CGACATCCTGATCGTTCGATCTGTCTTATAATAACTTGTCAGGCATCATTCCAAGTAGTCTGGGTAGTTGTGTCACTCTAG
AA sequence Show only first row Show all	>Lus10024681 pacid=23161669 polypeptide=Lus10024681 locus=Lus10024681.g ID=Lus10024681.BGIv1.0 annot-version=v1.0 MFVGGIPPEIGRLHRLQKPVLNNNSLGGEIPPNISGCSAQTVLQVKRNKLVGGLPWQIGLLNKLQYFSVSVNNLSGSIPPSFGNLSSLQEFRAATHQMSG RHPDRSICLIITCQASFQVVWVVVSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G20480		EFR	EF-TU receptor (.1)		Lus10024681 [exp]	0	1
AT2G43060	bHLH	AtIBH1, bHLH158	ILI1 binding bHLH 1 (.1)		Lus10026730 [exp]	1.0	0.8567
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Lus10005139 [exp]	4.2	0.7985
AT2G03210		ATFUT2, FUT2	fucosyltransferase 2 (.1)		Lus10026125 [exp]	8.9	0.7557
AT5G53110			RING/U-box superfamily protein...		Lus10019018 [exp]	11.2	0.7924
AT1G33170			S-adenosyl-L-methionine-depend...		Lus10010152 [exp]	12.2	0.7914
AT4G16370		ATOPT3	oligopeptide transporter (.1)		Lus10038784 [exp]	15.4	0.7991
AT1G22150		SULTR1;3	sulfate transporter 1;3 (.1)		Lus10029616 [exp]	20.5	0.7850
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10021872 [exp]	20.5	0.7713
AT2G45910			U-box domain-containing protei...		Lus10016557 [exp]	22.5	0.7671
AT3G43660			Vacuolar iron transporter (VIT...		Lus10028596 [exp]	22.8	0.7849

Compare expression of checked genes

Lus10024681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.