Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16930 64 / 9e-13 F-box/RNI-like/FBD-like domains-containing protein (.1) AT1G78760 63 / 1e-12 F-box/RNI-like superfamily protein (.1) AT3G59200 63 / 1e-12 F-box/RNI-like superfamily protein (.1) AT5G56440 62 / 2e-12 F-box/RNI-like/FBD-like domains-containing protein (.1) AT1G69630 62 / 3e-12 F-box/RNI-like superfamily protein (.1) AT1G66310 62 / 3e-12 F-box/RNI-like/FBD-like domains-containing protein (.1) AT5G22730 61 / 7e-12 F-box/RNI-like/FBD-like domains-containing protein (.1) AT5G22720 61 / 1e-11 F-box/RNI-like superfamily protein (.1.2) AT5G18780 60 / 1e-11 F-box/RNI-like superfamily protein (.1.2) AT1G60400 60 / 1e-11 F-box/RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023037 [exp] 100 / 2e-26 AT1G16930 74 / 2e-14 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10020292 [exp] 97 / 5e-25 AT1G60410 76 / 9e-15 F-box family protein (.1) Lus10029357 [exp] 96 / 3e-24 AT3G28410 79 / 1e-15 F-box/RNI-like superfamily protein (.1) Lus10024696 [exp] 94 / 1e-23 AT5G22720 75 / 1e-14 F-box/RNI-like superfamily protein (.1.2) Lus10023036 [exp] 92 / 1e-23 AT1G16930 66 / 3e-12 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10002239 [exp] 91 / 7e-23 AT1G69630 91 / 5e-20 F-box/RNI-like superfamily protein (.1) Lus10024695 [exp] 87 / 3e-21 AT1G69630 83 / 3e-17 F-box/RNI-like superfamily protein (.1) Lus10001507 [exp] 87 / 3e-21 AT5G56440 91 / 6e-20 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10042477 [exp] 87 / 4e-21 AT1G16930 77 / 2e-15 F-box/RNI-like/FBD-like domains-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G011200 [exp] 74 / 2e-16 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1) Potri.001G337200 [exp] 71 / 2e-15 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2) Potri.015G002100 [exp] 70 / 5e-15 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1) Potri.011G024300 [exp] 61 / 5e-12 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2) Potri.011G104100 [exp] 60 / 1e-11 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.011G104300 [exp] 59 / 3e-11 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1) Potri.011G104200 [exp] 58 / 9e-11 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.015G002001 [exp] 54 / 2e-09 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.011G121500 [exp] 54 / 2e-09 AT4G14103 142 / 6e-38 F-box/RNI-like superfamily protein (.1.2) Potri.011G024200 [exp] 54 / 2e-09 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10024701 pacid=23161637 polypeptide=Lus10024701 locus=Lus10024701.g ID=Lus10024701.BGIv1.0 annot-version=v1.0 ATGAACAACTGCTGTATCTCTCCGCTGGGGAAAGCTGCGAAAAGGGCTCGTAAAGAAGAAGACGCTGTTGTTGCTGATAGGTTAAGTTATCTTCCTGATT ACATCATTCATCACATCCTTTCGTTTCTGGATGCCAAATGTGTGGTTCAGACCTCTGTTTTGTCACGGGAGTGGAGGCACATGTGGAAACATGTCCCTGC ACTCAATTTCCTTAGAGATTCCTTCAGAAATGGACAGAGCTTCGTTAGGTTTCTGAACAGGTTCATGAACCTTCGTTCTCCACTTAGTGTCTGCAAGATC AGCTTTGTCGACAAGTTAGCCTCAAGGAAGCCGAATATAGGGACTTGCTTGGCAGGGTCATGA
AA sequence Show only first row Show all	>Lus10024701 pacid=23161637 polypeptide=Lus10024701 locus=Lus10024701.g ID=Lus10024701.BGIv1.0 annot-version=v1.0 MNNCCISPLGKAAKRARKEEDAVVADRLSYLPDYIIHHILSFLDAKCVVQTSVLSREWRHMWKHVPALNFLRDSFRNGQSFVRFLNRFMNLRSPLSVCKI SFVDKLASRKPNIGTCLAGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78760			F-box/RNI-like superfamily pro...		Lus10024701 [exp]	0	1
AT1G03670			ankyrin repeat family protein ...		Lus10020209 [exp]	1.4	0.8648
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Lus10036200 [exp]	2.2	0.8744
AT4G11070	WRKY	ATWRKY41, WRKY4...	WRKY family transcription fact...		Lus10003894 [exp]	3.2	0.8338
AT2G20495			unknown protein		Lus10024909 [exp]	6.0	0.8264
AT5G66900			Disease resistance protein (CC...		Lus10033299 [exp]	6.6	0.8435
AT5G14850			Alg9-like mannosyltransferase ...		Lus10034759 [exp]	6.9	0.8077
AT3G10572		APEM9	ABERRANT PEROXISOME MORPHOLOGY...		Lus10021597 [exp]	7.5	0.8317
AT4G36980			unknown protein		Lus10019346 [exp]	11.2	0.8139
AT2G24960			unknown protein		Lus10026250 [exp]	12.0	0.8334
AT4G00960			Protein kinase superfamily pro...		Lus10015423 [exp]	13.2	0.8328

Compare expression of checked genes

Lus10024701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.