Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23430 107 / 1e-29 AtTic32-IVa translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT5G02540 107 / 3e-29 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G11410 101 / 3e-27 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G23420 101 / 4e-27 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) AT2G37540 98 / 1e-25 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G50130 77 / 4e-18 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT4G24050 70 / 2e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G64590 66 / 8e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G54190 40 / 0.0001 PORA protochlorophyllide oxidoreductase A (.1.2) AT4G27440 39 / 0.0002 PORB protochlorophyllide oxidoreductase B (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024685 [exp] 165 / 1e-51 AT4G23430 431 / 4e-152 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024648 [exp] 143 / 3e-43 AT4G23430 447 / 2e-159 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10024647 [exp] 137 / 1e-40 AT4G11410 461 / 1e-164 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10032282 [exp] 134 / 1e-39 AT4G23430 459 / 8e-164 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10032281 [exp] 131 / 1e-38 AT4G11410 447 / 2e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024649 [exp] 129 / 1e-37 AT4G11410 446 / 5e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10035481 [exp] 122 / 3e-35 AT4G23430 479 / 6e-172 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10031101 [exp] 121 / 7e-35 AT4G23430 478 / 1e-171 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Lus10038857 [exp] 120 / 5e-34 AT4G23430 436 / 2e-154 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G128700 [exp] 125 / 2e-36 AT4G11410 497 / 4e-179 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.003G128800 [exp] 115 / 1e-32 AT4G23420 442 / 5e-157 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.015G146600 [exp] 112 / 3e-31 AT4G23420 444 / 6e-158 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.001G103000 [exp] 111 / 7e-31 AT4G11410 446 / 4e-159 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.012G143600 [exp] 110 / 4e-30 AT4G23430 401 / 2e-140 translocon at the inner envelope membrane of chloroplasts 32-IVa, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.012G143800 [exp] 106 / 5e-29 AT4G23420 427 / 3e-151 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3) Potri.006G083900 [exp] 103 / 9e-28 AT5G02540 452 / 3e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.T124508 [exp] 82 / 5e-20 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.015G081102 [exp] 82 / 5e-20 AT5G50130 454 / 2e-161 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.012G087800 [exp] 73 / 2e-16 AT5G50130 426 / 4e-150 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024707 pacid=23161580 polypeptide=Lus10024707 locus=Lus10024707.g ID=Lus10024707.BGIv1.0 annot-version=v1.0 ATGCTGTGTGCTTATGCGCAAGCGAAGCTTGCTAACCTTGTTCATGCTAATGAGCTCGCAAGGCGCTTCCAAGAGGGAGTCAATGTAACTGCCAATTCAC TTCACCCTGGAAAAATACCAACAAACCTTTTTCGCCACACAGGAGCTATTAGCAGTAAACTCTATCCATATCGCCATGTTAATATCGCATCCTTGAAAAG CGATACAACTACATGCTATGTGGCATTGCATCCACAAGTGAAGGGAGTAAGTGGAGAATACTTCCGGGACAGTAACGTATCGAAAGCGACCCCTCTGGCT ATAGATGAAGAATTATGA
AA sequence Show only first row Show all	>Lus10024707 pacid=23161580 polypeptide=Lus10024707 locus=Lus10024707.g ID=Lus10024707.BGIv1.0 annot-version=v1.0 MLCAYAQAKLANLVHANELARRFQEGVNVTANSLHPGKIPTNLFRHTGAISSKLYPYRHVNIASLKSDTTTCYVALHPQVKGVSGEYFRDSNVSKATPLA IDEEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02540			NAD(P)-binding Rossmann-fold s...		Lus10024707 [exp]	0	1
					Lus10017806 [exp]	1.4	0.8455
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10010863 [exp]	3.5	0.7901
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10005238 [exp]	7.6	0.8503
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10027816 [exp]	13.3	0.7066
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10025692 [exp]	17.8	0.7885
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Lus10013753 [exp]	20.1	0.7746
AT4G08630			unknown protein		Lus10004138 [exp]	23.0	0.7221
AT4G35220			Cyclase family protein (.1)		Lus10027872 [exp]	27.6	0.7075
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10027988 [exp]	29.5	0.7074
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	31.3	0.7074

Compare expression of checked genes

Lus10024707 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.