Lus10024714 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64160 173 / 2e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G23690 172 / 9e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 152 / 3e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 139 / 5e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 66 / 2e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 64 / 1e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 63 / 2e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 62 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49030 62 / 2e-11 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024715 360 / 3e-129 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032331 345 / 4e-123 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017538 250 / 2e-85 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10028749 168 / 4e-53 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017539 165 / 5e-52 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 74 / 1e-16 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 72 / 2e-15 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 70 / 4e-15 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032939 70 / 4e-15 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142602 289 / 6e-101 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 289 / 6e-101 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134800 287 / 4e-100 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 285 / 1e-99 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 285 / 2e-99 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134600 275 / 1e-95 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142702 252 / 2e-86 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 252 / 2e-86 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134400 207 / 8e-69 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096440 194 / 4e-64 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10024714 pacid=23161554 polypeptide=Lus10024714 locus=Lus10024714.g ID=Lus10024714.BGIv1.0 annot-version=v1.0
ATGACTATCTCAAGAAGCAAGATTGCTCTCTTCTTCATCTTCTTCATCTACCTTTCCTCAACTTCTTCATCAGCCAAGAAGAAGCAACACGCTCCATGCA
AGGAGCTAGTACTCTTCTTCCACGACATCATCTACAACGGCCAGAACAAGGCCAACGCCACCGCGGCCATCGTGGCGGCTCCCGAGGGCTCCAACCGGAC
CATCCTGGCCGGCGAGTCCCATTTCGGGAACATAGCCGTATTCGATGACCCGATCACCCTCGACAACAACCTGCACTCTCCGCCCGTCGGCAGGGCTCAG
GGGATGTACCTGTACGACACTAAGAACACGTTCACTGCCTGGTTGGGTTTCACTTTTTGTCTTAATAGTACGGAGCACCAAGGTACGATTAACTTCATGG
GAGCCGACCCGCTTATGAACAAGACTAGGGATGTGTCGATTGTTGGTGGGACCGGCGACTTCTTTATGCACCGTGGGGTGGCGACCATCATGACGGACTC
GTATGAAGGTGAAGTGTACTTTAGGCTTCGAGTTGACATGAAGTTCTACGACTGTTGGTGA
AA sequence
>Lus10024714 pacid=23161554 polypeptide=Lus10024714 locus=Lus10024714.g ID=Lus10024714.BGIv1.0 annot-version=v1.0
MTISRSKIALFFIFFIYLSSTSSSAKKKQHAPCKELVLFFHDIIYNGQNKANATAAIVAAPEGSNRTILAGESHFGNIAVFDDPITLDNNLHSPPVGRAQ
GMYLYDTKNTFTAWLGFTFCLNSTEHQGTINFMGADPLMNKTRDVSIVGGTGDFFMHRGVATIMTDSYEGEVYFRLRVDMKFYDCW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23690 Disease resistance-responsive ... Lus10024714 0 1
AT4G23690 Disease resistance-responsive ... Lus10024715 1.0 0.9955
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10016720 2.0 0.9861
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10036014 3.5 0.9867
AT3G26230 CYP71B24 "cytochrome P450, family 71, s... Lus10019461 6.8 0.9880
Lus10024873 6.9 0.9783
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10029368 7.7 0.9813
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008917 10.2 0.9857
AT5G52400 CYP715A1 "cytochrome P450, family 715, ... Lus10027480 10.5 0.9752
AT1G17860 Kunitz family trypsin and prot... Lus10026357 12.3 0.9820
AT5G49630 AAP6 amino acid permease 6 (.1) Lus10007235 13.0 0.9728

Lus10024714 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.