Lus10024715 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64160 173 / 2e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G23690 172 / 7e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 153 / 2e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 147 / 4e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 139 / 4e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 64 / 5e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 64 / 6e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 62 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 62 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 60 / 2e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024714 341 / 1e-121 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032331 339 / 7e-121 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017538 251 / 9e-86 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017539 168 / 3e-53 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10028749 168 / 6e-53 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 71 / 2e-15 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 70 / 5e-15 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 69 / 9e-15 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032939 69 / 1e-14 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G134800 288 / 2e-100 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142602 286 / 5e-100 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 286 / 5e-100 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 286 / 5e-100 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 286 / 8e-100 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134600 276 / 5e-96 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142702 251 / 5e-86 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 251 / 5e-86 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134400 209 / 1e-69 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096440 194 / 4e-64 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10024715 pacid=23161548 polypeptide=Lus10024715 locus=Lus10024715.g ID=Lus10024715.BGIv1.0 annot-version=v1.0
ATGACTATCTCAAGAAGCAAGATTGCTCTCTTCTTCATCTTCTTCATCTACCTTTCCTCGACTCCTTCATCAGCCAAGAAGAAGCAACACGCTCCATGCA
AGGAGCTAGTACTCTTCTTCCACGACATCATCTACAACGGCCAGAACAAGGCCAACGCCACCGCGGCCATCGTGGCGGCTCCCGAGGGCTCCAACCGAAC
CATCCTGGCCGGCGAGTCCCATTTCGGGAACATAGCCGTATTCGATGACCCGATCACCCTCGACAACAACCTGCACTCTCCGCCCGTCGGCAGGGCTCAG
GGGATGTACCTGTACGACACTAAGAACACGTTCACTGCCTGGTTGGGTTTCACTTTTTGTATTAATAGTACGGAGCACCAAGGTACGATTAACTTCATGG
GAGCCGACCCGCTTATGAACAAGACTAGGGATGTGTCGATTGTTGGTGGGACCGGCGACTTCTTTATGCACCGTGGGGTGGCGACCATCATGACGGACTC
GTATGAAGGTGATGTATACTTTAGGCTTCGAGTTGACATGAAGTTCTACGAATGTTGGTGA
AA sequence
>Lus10024715 pacid=23161548 polypeptide=Lus10024715 locus=Lus10024715.g ID=Lus10024715.BGIv1.0 annot-version=v1.0
MTISRSKIALFFIFFIYLSSTPSSAKKKQHAPCKELVLFFHDIIYNGQNKANATAAIVAAPEGSNRTILAGESHFGNIAVFDDPITLDNNLHSPPVGRAQ
GMYLYDTKNTFTAWLGFTFCINSTEHQGTINFMGADPLMNKTRDVSIVGGTGDFFMHRGVATIMTDSYEGDVYFRLRVDMKFYECW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23690 Disease resistance-responsive ... Lus10024715 0 1
AT4G23690 Disease resistance-responsive ... Lus10024714 1.0 0.9955
AT3G26230 CYP71B24 "cytochrome P450, family 71, s... Lus10019461 5.3 0.9918
AT1G17860 Kunitz family trypsin and prot... Lus10026357 5.9 0.9874
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10029368 6.9 0.9827
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10024120 7.3 0.9888
AT3G48320 CYP71A21 "cytochrome P450, family 71, s... Lus10019460 9.6 0.9886
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10016720 10.7 0.9800
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10036014 10.8 0.9823
AT3G26210 CYP71B23 "cytochrome P450, family 71, s... Lus10030708 11.0 0.9806
AT4G02780 ATCPS1, ABC33, ... GA REQUIRING 1, CPP synthase, ... Lus10022047 11.2 0.9840

Lus10024715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.