Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18210 40 / 0.0001 Calcium-binding EF-hand family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001257 [exp] 129 / 8e-40 ND 42 / 1e-05 Lus10031345 [exp] 54 / 2e-09 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 52 / 7e-09 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10042008 [exp] 50 / 2e-08 AT1G18210 138 / 1e-42 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 45 / 2e-06 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G048200 [exp] 41 / 3e-05 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.015G039500 [exp] 41 / 6e-05 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024718 pacid=23161643 polypeptide=Lus10024718 locus=Lus10024718.g ID=Lus10024718.BGIv1.0 annot-version=v1.0 ATGGGATCCAACTACTCTACTCTTGACCTGCAGCGCGCCATGTACGACGTCGACACCGACAAGGACGGGTGCATAAACTTGGAGGAGTTCCCGAGCTCTG CTGTTCATCTTCCGGAGCGTCCGCGACGGCGGAGCTTCACGAGGCGTCTTCATCTCCTAGAATCGATTCATCTTTCTCCCAGAATAGATCTCCCATCTTC CATCTTTGATCCATCTTCATCTCCCACAATCGATCCATCTCCATCTCACAGAATTGATCCATCTTCATCTCACAGAATCGATACATCTTTGGTCCCGCCG TTGCCGTATACTTCCCACCGGACTGGGATTAGGTCGTCGTTGGCGGCGGCGGAGGATCCGACGGCGGGCGGAGGAGGATGA
AA sequence Show only first row Show all	>Lus10024718 pacid=23161643 polypeptide=Lus10024718 locus=Lus10024718.g ID=Lus10024718.BGIv1.0 annot-version=v1.0 MGSNYSTLDLQRAMYDVDTDKDGCINLEEFPSSAVHLPERPRRRSFTRRLHLLESIHLSPRIDLPSSIFDPSSSPTIDPSPSHRIDPSSSHRIDTSLVPP LPYTSHRTGIRSSLAAAEDPTAGGGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024718 [exp]	0	1
AT1G80940			unknown protein		Lus10024095 [exp]	3.5	0.8100
AT5G40060			Disease resistance protein (NB...		Lus10002248 [exp]	4.7	0.8184
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10010960 [exp]	6.1	0.8253
AT4G15545			unknown protein		Lus10034001 [exp]	6.5	0.8134
AT4G01130			GDSL-like Lipase/Acylhydrolase...		Lus10012644 [exp]	9.6	0.7613
AT1G05700			Leucine-rich repeat transmembr...		Lus10023463 [exp]	11.0	0.7085
AT4G38810			Calcium-binding EF-hand family...		Lus10007567 [exp]	15.9	0.7855
AT3G47490			HNH endonuclease (.1.2.3)		Lus10034462 [exp]	16.4	0.7920
AT4G15545			unknown protein		Lus10012775 [exp]	20.4	0.7623
					Lus10034752 [exp]	22.4	0.7952

Compare expression of checked genes

Lus10024718 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.