Plant FIBer expression Database

Lus10024719 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41650 196 / 2e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT1G64185 188 / 2e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032333
[exp]
236 / 2e-82 AT5G41650 196 / 1e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10025564
[exp]
86 / 1e-20 AT5G46680 276 / 2e-88 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G135100
[exp]
210 / 6e-72 AT5G41650 207 / 5e-71 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Potri.001G237500
[exp]
42 / 9e-06 AT1G07645 215 / 3e-73 dessication-induced 1VOC superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10024719 pacid=23161620 polypeptide=Lus10024719 locus=Lus10024719.g ID=Lus10024719.BGIv1.0 annot-version=v1.0
ATGGCCTCGTTCAGGTGGATCCTGCAACTCCACAAGGATGTTCCCAAGGCGGCTCGTTTCTATTCCGAAGGGCTGGATTTCACCGTCAATGTATGCACCC
TACGCTGGGCTGAACTTCATTCGGGGCCTCTGAAGCTCGCCCTCATGCAATCTACCAACGATAATGTTTCACAGGAGGGGCATTCTAATTTGCTATCATT
CACAGTCACTGACATCAACAGTACGGTGACAAAGCTAATGGCTTTAGGTGCTGAGCTAGATGGCCCCATCAAGTATGAAATTCATGGGAAGGTTGCAGCC
ATGCGTGGTATGGACGGCCACGTCTTAGGACTCTATGAACCAGCATAA
AA sequence
>Lus10024719 pacid=23161620 polypeptide=Lus10024719 locus=Lus10024719.g ID=Lus10024719.BGIv1.0 annot-version=v1.0
MASFRWILQLHKDVPKAARFYSEGLDFTVNVCTLRWAELHSGPLKLALMQSTNDNVSQEGHSNLLSFTVTDINSTVTKLMALGAELDGPIKYEIHGKVAA
MRGMDGHVLGLYEPA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G41650 Lactoylglutathione lyase / gly... Lus10024719
[exp]
0 1
AT4G38900 bZIP AtbZIP29 Basic-leucine zipper (bZIP) tr... Lus10018061
[exp]
4.1 0.7423
AT4G09940 P-loop containing nucleoside t... Lus10028023
[exp]
9.8 0.6981
AT5G16920 Fasciclin-like arabinogalactan... Lus10039146
[exp]
11.3 0.7053
AT1G24110 Peroxidase superfamily protein... Lus10029201
[exp]
14.3 0.7068
AT1G02475 Polyketide cyclase/dehydrase a... Lus10009002
[exp]
14.8 0.6540
AT1G01490 Heavy metal transport/detoxifi... Lus10027524
[exp]
18.0 0.7053
AT5G10190 Major facilitator superfamily ... Lus10027265
[exp]
24.0 0.6880
AT3G56710 SIB1 sigma factor binding protein 1... Lus10039494
[exp]
28.1 0.6957
AT5G63800 MUM2, BGAL6 MUCILAGE-MODIFIED 2, beta-gala... Lus10033500
[exp]
30.7 0.7033
AT5G61510 GroES-like zinc-binding alcoho... Lus10009018
[exp]
31.2 0.6458

Lus10024719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.